EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07395 alignment
(5 sequences with 275 aa)


Q9HUG2_PSEAE/35-298 HPLVVEQLAEMAGIPVRYLGWESAGELVAAIPTWGRHLALSKDVLKRRGKKGLYDLGNAELILPVAGDARIALRHAGRYLSALHERNIVTLR---PQTEQLAFARAPEDFSKKFRYNQRREVRLVEEAGGQVRQADSFAPAEFAAIYLELFQRRWG--FPATGAERMAEVFERLRELLRGSVLLLNDQPIAVQVLYRAEAPGWLSVEYINGGV--DPQTREFSPGSVLSYLNTQAAWEDARALGKPLRYSFG--RADREYKDRWCHPSPVFQ--V
Q88D85_PSEPK/35-298 HPLVVEQLADLAQIPVRYLGWHQAGELQAAIPAWGRHLALSKDVLKRAGKKALFDLGNAEIILPAASDAAAPLRHTMRYLSELNQGRFSGLK---AQKEQLAMARAPEDLSKKFRYNQRRELRLLEEAGGVVRPISDFSAQEIASMYCDLFLRRWG--FPATGAERMADVLERLRELLIGSVLLLDGKPIAIQLVYRVEAPEWISVEYINGGV--DPETKAFSPGSVLSFLNTQAAWEDARSRNKPLRFSFG--RADREYKDRWCNPVPVYQ--A
Q87VE7_PSESM/35-298 HPLVVARLSEFSGIPVRYLAWEQGGEVKAAIATWGRSLALSKDELKRHGKKGLFDLGNAELILPVAEGVQVPVRHRARYVSALNEGRISTLK---SQTESLAMARTPEELSKKFRYNQRRELRLLEEAGGTVRPVSEFSSAELASMYCDLFQRRWG--FEATGARDKAQVIELLRDLLIGSVVFLNDAPIAIQLVYRVEAPQWVSIEYVNGGV--DPETRDFSPGSVLSFVNTQSAWEDARALGKALRFSFG--RADREYKDRWCNPVPVFQ--L
Q9F148_ECOLI/2-225 HPDVVSFFMKNHAWKIDFFHYEKNGDIKGA-------YFLCNGTQVGIMARRRYPLSSDEILIPFDSHTKWFFPDKTNKLSMINKPNIINATWSIARKKQNCIIK--EDFSRNFENRRRNEVQRFIRNGGEIKCIEELSDSEIARLYISLFKSRFGNMLPCYKYDDLLRFVSYLRKMIFGYVLFWNNKPCAIDIVLKSESSCNVYYDVPNGAILNDDGCMKVSPGSVPYVVK------------------------------------------Y
Q8Z4G7_SALTI/35-298 HPDIVDYFMKRHNWHFKFFHYKEDDKIKGA-------YFICNDQNIGILTRRTFPLSSDEILIPMAPDLRCFLPDRTNRLSALHQPQIRNAIWKLARKKQNCLVK--ETFSSKFEKTRRNEYQRFLKKGGSVKSVADCSSDELTHIFIELFRSRFGNTSSCYPADNLANFFSQLHHLLFGHILYIEGIPCAFDIVLKSESQMNVYFDVSNGAI--KNECRPLSPGSILMWLNISRARHYCQERQKKLLFSIGILKPEWEYKRMWSTPYFTGKSIC