EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07361 alignment
(8 sequences with 108 aa)


C5621_YERPE/22-127 ASLQDDMNILIANLGIVSSSTDTKVITSSLEKMRNAALDAQKA-IPPKLEGKAEDSPEIK-DYRHGFDLLIEQIDKTKQWAEEGNIQEVKKSVGEVINIRNTYHSRYR
C5622_YERPE/23-128 ASVADDMETIAEHYGKVLKADSTAVIKQDLQAMRVAAVDAQKG-IPTKLKSKVEDSPEMK-DFRHGMDVLIGEIDGALALADQGKLDEAKQAAQDFKDTRNTYHKKYR
C562_ECOLI/23-128 ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKA-TPPKLEDKSPDSPEMK-DFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
O32554_ECOLI/26-129 EELDESMQVLARNMSVLQSSMDKKELLEALDRMDDAVDESMKR-LPESI---SPADEEGKNDYIKELQKLEKEIMLAKQKVLSGQLSDIPDSVNKMNKIRVEGHDKFR
Q9KL55_VIBCH/63-160 QDLKSIMQDMKLAFKQAAEATTVEAMQAPISTLESLVEQAKRGVYPVEK---------EA-TYQEGFQKLAVTLDKIDAHLQAGELEAAKASLKTVDDLRIEYHDKRN
Q87FZ4_VIBPA/23-120 VDLKQNMKQMKMEFKQAAEASDVETMKSAIDSLQAIVEQSKRGNYPPEK---------FD-TYLEGFNKLSVTLDKIEADLDAGNLTEAKAQLREIDSLREEYHDKRN
Q8D455_VIBVU/27-124 VDLKANMKEMKLEFRQAAEAQDIESMQAAVNQLRSLVENSKTGEYAPEK---------ND-LYHEGFNKLTVALDKVNGELEQGNLEAAKQALVEVDELRKEYHEKKK
Y670_PASMU/23-124 ANVRAEMNQMKTVAATLTNAKDVAEFQESAKILREIAQQSSEK-RPSSI----TNDADFK-GYQEGMKEFITALDEADKLAQEGNLDAAKTAAKKLFDIRNVYHKKYK