EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07354 alignment
(5 sequences with 275 aa)


ZPBP1_CHICK/58-320 VTNRLRNSELIDPVFRWNGPSGYLSSANSSVQISPTGTLILGHFRSDLSGVYTCSLVYKLIAAQPD----KRLTIKYHIYAYSDPQYYYELTVQYHAAPCNSFHNTSFGRALLQILSKLVADLSCEVSLIKSECHHVKMQRGGLQSEMFFKFSVTCLDTENNKLCRQ-SA-CDKPHR--LHKAKDLIERFFKREVEIRKKSTEP-LPEIYYIEGTLQMVWVDRCYPGYGINAVRHPDCPECCVICSPRSYNPSNGIHCLQCDTSLI--YGATTC-
ZPBP1_PIG/86-350 VTQRLRNFELVDPSFQWHGPKGKIVSENSTAQVTSTGSLVFQNFEESMSGVYTCFLEYKP----TVEEVVKNLQLKYIIYAYREPRYYYQFTARYHAAPCNSIYNISFEKKLLQILSKLVLDLSCEVSLLKSECHRVKMQRAGLQNELFFTFSVSSLDTEKGPKPCA-GHSCESSKR--LSKAKNLIERFFNQQVEVLGRRAEP-LPEIYYIEGTLQMVWINRCFPGYGMNILKHPKCPECCVICSPGTYNSRDGIHCLQCNSSLV--FGAKACL
ZPBP2_CHICK/79-352 MDLSLSQEEIIDPKYSWTGPDGRNLEGRGYANLTGSGELMLVGFQESMSGAYTCTLSHRIIETSAQEEVDVRDTYRFMVYAYREANHVYQVSVRFTAKGCELAANARFVEELKKIMESLISDLTCGVKGPSYRCHSLEAPHRGSPSELFITFQVNPFAPGWEDLCSRLPQDCEDTTNRRAQEATERIGEFFRKQTYALKHQFQT-VPTIHYVEGSFSVTPIDSCRPGFGRNNITHRSCAGCCVVCSPGTYSPDSAGSCRVCAGRRTAGYGAKSCP
ZPBP2_HUMAN/56-327 MDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNG-SVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLT--YGAKSCP
ZPBP2_RAT/55-326 MDIDRASKETVDPIYLWIGPNENTLTGSSQINITNIGELVLKDFMESLSGHYSCTLSYKIVKAETQEETSLKKKYDFLVFAYREPDYSYRMAVRFTTKSCVGRYNDLLFRLLKKILDNLISDLLCHVIEPSYKCHSVKIPERDFVYELFVAFQVNPFAPGWKSMCNS-SMDCEDVTNHNILKARDRIEEFFRSQAYILHHHFNITVPAMHFVDHSFQVTRIDNCRPGFGKNEGLHSNCASCCVVCSPGTFSPDMDVTCQTCVSAHV--YGAKACP