EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07176 alignment
(10 sequences with 135 aa)


Q8DKB8_SYNEL/26-151 AANFVSLTYGPFQR-SFPLSELEEFVSTKEATGQLRGLMRLV--SKDDQAKLLEFLGMRLPFNVVQTDQIL----ASPIGKDLLKQFSQVT-IRRDQAGEVALRGAMITAAASPE-GLSMMSFLKNYPGETINLD
Q8DJF1_SYNEL/29-156 AAEEISLIYPPFGTFNIQVSDLATFAKTGHTSPELRFLIQLL--PSDQGPNLRESLTTRMNLEPTTVSQFV----KSPIGQSFLERIGQVIRADNDVNGGQALGEALTTAASSPS-GITLLSVLQAFPGKSVRVN
Q8YY82_ANASP/24-151 SAERISLFYPPFGEFSLPVSSLETFAKEGKIDSDLQFYAQRA--TPAQLAQLREFLQQRFDVTPTFISQIT----YSPIGEQVLQRLGDIVQTDSRRNGFYALRSALILSAAKPQ-GFSVINVLRNFPSDNLRLN
Q8DI73_SYNEL/34-160 AAEQIIFRYGPFER-SLPIADLEWFATTGQSSPKLASYLRLF--PPGHRQQLRLALQERLRLSPVAVAQLL----YSPLGQEFMVQAGRILQTQSRQENALALRAALILAATDPN-GLTVLSVMRHYPSPSIRFD
Q8YQI8_ANASP/27-152 AAERVVLKYKVFRE-TIVVEELSTFAQTGALSSSLRINLAL---ARQNPKVIRQYLTTPIKVSPVLLDRVL----NSPVGNIILDELSQVIHTPSRSADRQALRSALVLSASGDG-QVTLIEIIQNYPTPNVEID
P72989_SYNY3/33-158 AAERVVLTYSVLRE-SISIEELGELSRTGKVSPSLKAYLKM---ANKNPEELRGWLNRPFQADPVTLSRVL----NSFAGEYVLNQVGQVIHTPSKRDNKEALRGAIISSAEKDN-QVRLIEVLENYPTPELHVN
Q8YVC8_ANASP/32-157 AAETVVVRFGLFAE-SIPVADLQKAAETGEFPSSLNLFTRRL--SEQQRRTIIGALRMRVPLNVVTISRLL----NTQIGTTILNDLSTAV-VRKDQSGAKALRASLVLGSTAPQ-GLSILSFIAAYPSQSLEIN
Q8RSV9_SYNP2/31-153 AAETLRLKLGPLQQ-TLQLEDLETFAETGQVPRNFRPYGVFL---DGNLQK---FLQRRLQIEPEMADQFFDQLWRSPTGKQILAQIQTAL--PGTSIQDL---QATVDLALGQGVEISALNLLQAYPKQELTID
P74506_SYNY3/27-153 GAETITFSIMPLGQFDISVKSLTDFAETGTIDPDFKFYTQHL--KPEELEKLRGLLNHSFKFNSVEAFRFF----NTTFGKEIAQQLSYIIAAPTDQSQPF-LEGAIVTAAQNPD-GFKIIDVINAYGGSDLVLN
P73946_SYNY3/76-204 TAENIFFTYGPIKL-TVRVESLERFVQDGTVDSNLSFLFNLVGASEEKLAKLREIMGLRAEVDPVVLSNFF----NTSLGEDSLARAAVILNAPWGANSKYGIRAAIVQAAEDPEGGLSLINFIKKYPT-DIHFQ