EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07158 alignment
(5 sequences with 149 aa)


Q9ZIP4_RHILE/1-149 MGIELLSIGLLIAMFIIATIQPINMGALAFAGAFVLGSMIIGMKTNEIFAGFPSDLFLTLVAVTYLFAIAQINGTIDWLVECAVRLVRGRIGLIPWVMFLVAAIITGFGALGPAAVAILAPVALSFAVQYRIHPVMMGLMVIHGAQAGG
Q8P4U0_XANCP/1-149 MTPQIATILGLVIMFIVATALPINMGAVAFALAFIIGGVWVGLDGKEVLAGFPGDLFLTLVGITYLFAIAQKNGTIDLLVHWAVRAVRGRIVAIPWVMFVITGLLTAFGALGPAAVAIIGPVALRFAKQYRINPLMMGLLVIHGAQGGG
Q9L0A3_STRCO/1-149 MSPELISILVLVVVFVIATTRSVNMGALAFAAAFGVGTLVADLDADGIFAGFPGDLFVVLVGVTYLFAIARANGTTDWLVHAAVRLVRGRVALIPWVMFALTGALTAIGAVSPAAVAIVAPVALSFATRYSISPLLMGTMVVHGAQAGG
Q9KIE8_STRHY/1-149 MPNELTGVLILAAVFLLAGVRGLNMGLLALVATFLLGVVALDRTPDEVLAGFPASMFLVLVAVTFLFGIARVNGTVDWLVRVAVRAVGARVGAVPWVLFGLAALLCATGAASPAAVAIVAPISVAFAVRHRIDPLYAGLMAVNGAAAGS
P72556_STRPN/1-148 M-IHLIMISAIALAIGIGYRTKINIDLLAIAFSYLIATTLMGLSPKELLHFWPTSLFFTIFSVSLFYNFAITNGTLDVLAQHILYRTRTYPNALYMILYLMATLLSALGAGFFTTMAVCCPLAITLCQKVYKHPLIGAQAVNWGASGGA