EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07157 alignment
(10 sequences with 97 aa)


Q9JZC9_NEIMB/4-96 WHTLLQDASYKGVGFDIEVVD-ESNGKALAEHARPFVQGIDLEDMGMTGRQVQINAVFWGKGYAGRLKK---LLDALEQPGGGVLVHPVWGRMHNMI
Q9JR33_NEIMA/3-95 WKDTLLDAGFKGVTFDVIDDT-LRGTHALAEHEYPFVQGADIEDTGVSAMDMALTAVLWGEDYEGRLQN---LLNVLCETGAGELIHPIYGSVPDCV
Q8X2Y1_ECO57/8-101 MASGDGRGAFRGVPFLVWREQRERGGRNIVRREYPLRETGGADDLGPKLAEFTFSVLVMGDDVQTQRNR---LRDALRAPGAGELLHPDYGTLNVLI
VPN_BPMU/19-115 GRKTTGKGTFRNVPFLVIEEQKQAGGRRLVKREYPLRDTGGVNDLGKKLRSRTFSACILNSNAETARDEAGALMDALDAPGSGELVHPDFGTVDVMV
VPN_HAEIN/2-95 ASKITGKGSFRGVPFLIEEEQGLDGGRRIVSHEYPLRDEGLTEDMGKRLRRYQVSCLVIGDDHLAQAEK---LIDALEASGAGTLKHPYFGTIEVRV
Q8SBG8_BPSF5/8-100 WKDRLQDASFRGVPFKVEEES-AGTGRRVETHEYPNRDKPYTEDLGKVTFRPSITAYVVGDDCFDQRDR---LIDALNKPGPGTLVHPTYGELKVCV
Q8HAC1_9CAUD/9-101 WRGRLRDASFRGVPFSVEDDE-STFGRRVQVHEYPNRDKPWTEDLGRATRRLTINAYLVGDDYADRRDR---LIGAIETAGPGTLVHPQYGEMQGSI
Q88G61_PSEPK/4-96 WRDLRREASFRGVPFWVDSDS-VPVGRRTQLHEYPKRDQPLVEDMGRQTREYKFDGFIIGPDFISQRDR---LLVALDTPGPGELVHPWFGRLTVTA
Q88A16_PSESM/4-96 WRDSLLPASFRGVGFFIEKAV-VPVGRKGQLHEFPQRDEPYFESLGKQAQVHTLTAFIVGRDCFEKRDN---LLQALEKDGAGELVHPWLGRMQVQV
Q8EDP5_SHEON/2-94 AFEDRLTASFRGVEFLLEEAD-GESGRRAIPHAYPKKEIGYTEDNGKVLTQERISGRVVGADYFEQLQA---LLEALNKQGPGELVHPWFGIRKVQI