EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07155 alignment
(8 sequences with 182 aa)


Q9CIN2_LACLA/3-182 NNSVKIVVATGIGAALFVIIGWLINIPTPIPNTSIQLQYAVLALFSALFGPLAGFLIGFIGHALKDSFLYGAPWWTWVLGSGLIGLFLAFGVK--RETLTQGIFGNKEIIRFNIVQFLANVVVWGIIAPIGDVLVYSEPANKVFTQGIVAGLVNALTIAVAGTLLLKLYAATRTKSGSLDKE
Q8DY59_STRA5/33-212 TNTIKKVVATGIGAALFIIIGMLVNIPTPIPNTNIQLQYAVLALFAVIYGPGVGFFTGFIGHALKDSIQYGSPWWTWVLVSGLLGLMIGFFAK--KLAIQLSGMTKKDLLLFNVVQVIANLIGWSVVAPYGDIFFYSEPASKVFAQGFLSSLVNSITIGVGGTLLLLAYAKSRPQKGSLSKD
Q93D98_STRMU/3-181 NNSIKAVVATGIGAALFVIIGMFINIPL-FANTSIQLQYAVQAFLAVIFGPVVGFFIGLIGHMVKDMFAGYGIWWSWVIPSGLVGLGIGFLRN--RLHVEKGIFSTKDVVTFNIVQVLVNVLAWGVIAPLGDIIIFKEPASKVFVQGLLASVANALTVGVGATILLAIYAKSRTQAGSLSKD
Q97SA4_STRPN/4-182 KFTIKQVVAVGIGAALFVVIGM-INIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVGLIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRK--YVRVINGVFDWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLKKD
Q99QV6_STAAM/5-184 DISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLMTGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGL--KLNLSSGLFSRKSMIYFNIGQIIANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGSLRKE
Q8XK19_CLOPE/5-184 KLSIKTIVAIGIGSAVFMILGRFGSLPTGIPNTNIETAYAFLALMALLYGPLAGFLIGFIGHALKDIVFFGSPWISWVFASGIVGLIIGFGAR--FIKINQGVFKLKQIFMFNLIQIIANGVAWFLVAPTLDILIYSEPANKVYLQGVIGGISNMVTVGVLGTILIANYAKTRIQKGSLRKE
Q88ZZ1_LACPL/6-185 SNSIRTVVATGIGAAVIFVLMKFVAIPTGVPNTQVNVAMGFLALLGAIFGPVAAGLAVFIGHALNDFVTYGSPWWTWVIVDGLIGVAFGLAKN--RLKIENGVLGTAKLVWFNIYQIIVNFIGWVLLAPTGDIIIYHEPANKVYLQGVITWIADSISVAIIGTILLVLYARTRTQRGSLTKE
Q87G36_VIBPA/2-182 NLSAKTVVVIAIGAALYGIGGLPMFGIPVFANTTLKPAMAVLALFSVLFGPLVGFLVGFIGHWVTDLFAGWGVWLTWVLGSGIVGLIIGLFPSLTRYRLEKGDFNMKDFALFVVLALLGNVFGYGC-SAFLDTILYAEPFTKVFTQLSIIAIGNTILIAIVGFFILKSVAKRNKQSRNLTEA