EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07137 alignment
(3 sequences with 354 aa)


Q945R7_ORYSA/94-446 PSADAVDALKTCTCLLKECRIELAKCIANPSCAANVACLNTCNNRPDETECQIKCGDLFENTVVDEFNECAVSRKKCVPQKSDVGEFPVPDPSALVKNFNMADFNGKWYISSGLNPTFDTFDCQLHEFRVEGD-KLIANLTWRIRTPDSGFFTRTAIQRFVQDPAQPAILYNHDNEFLHYQDDWYIISSKVENKEDDYIFVYYRGRNDAWDGYGGAVLYTRSKVVPESIVPELERAAKSVGRDFSTFIRTDNTCGPEPPLVERIEKTVEQGEKTIIREVQEIEGEIEGEVKELEEEEVTLFKRLTDGLMEVKQDLMNFFQGLSKEEMELLDQMNMEATEVEKVFSRALPIRKLR
Q9SM43_SPIOL/120-472 SSAQAVDALKTCTCLLKECRIELAKCIANPSCAANVACLQTCNNRPDETECQIKCGDLFANKVVDEFNECAVSRKKCVPQKSDVGEFPVPDPSVLVKSFNMADFNGKWFISSGLNPTFDAFDCQLHEFHLEDG-KLVGNLSWRIKTPDGGFFTRTAVQKFAQDPSQPGMLYNHDNAYLHYQDDWYILSSKIENQPDDYVFVYYRGRNDAWDGYGGAFLYTRSATVPENIVPELNRAAQSVGKDFNKFIRTDNTCGPEPPLVERLEKTVEEGERTIIKEVEQLEGEIEGDLEKVGKTEMTLFQRLLEGFQELQKDEEYFLKELNKEERELLEDLKMEAGEVEKLFGRALPIRKLR
Q39249_ARATH/109-462 PSADAVDALKTCACLLKGCRIELAKCIANPACAANVACLQTCNNRPDETECQIKCGDLFENSVVDEFNECAVSRKKCVPRKSDLGEFPAPDPSVLVQNFNISDFNGKWYITSGLNPTFDAFDCQLHEFHTEGDNKLVGNISWRIKTLDSGFFTRSAVQKFVQDPNQPGVLYNHDNEYLHYQDDWYILSSKIENKPEDYIFVYYRGRNDAWDGYGGAVVYTRSSVLPNSIIPELEKAAKSIGRDFSTFIRTDNTCGPEPALVERIEKTVEEGERIIVKEVEEIEEEVEKEVEKVGRTEMTLFQRLAEGFNELKQDEENFVRELSKEEMEFLDEIKMEASEVEKLFGKALPIRKVR