EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07109 alignment
(15 sequences with 101 aa)


Q8YS90_ANASP/131-227 CLDVLIHYPQEKADEMISHLCSLAQSRIILSFAPKTCALTLLKKIGSFFPGPSKTTRAYLHREADVIKILES----NGFAIQRKEFTKTRFYFSRILEATR
CHLM_SYNY3/133-229 CLDVLIHYPTEEASAMISHLASLADRRLILSFAPKTLGLTVLKKIGGLFPGPSKTTRAYQHKEADIRKILGD----NGFSIARTGMTSTRFYYSRILEAVR
Q8DLN2_SYNEL/140-236 CLDVLIHYPDNQMAGMLAHLSSLAMERLILSFAPKTPKYTLLKKIGEFFPGASKATRAYLHSEEFIVEILGN----LGWRIERNAMTKTRFYFSRLLEAVP
Q9SNL7_ORYSA/224-320 CLDVLIHYPREEAKQMIRHLASLAEKRVLISFAPRTLYFDFLKRVGELFPGPSKATRAYLHSERDIEDALRD----AGWRVANRGFISTQFYFAKLFEAVP
Q9MUE2_TOBAC/228-324 CLDVMIHYPQSKADGMIAHLASLAENRLILSFAPKTFYYDLLKRIGELFPGPSKATRAYLHAEADVERALQK----AGWKIRKRGLIATQFYFAKLIEAVP
Q8GMR1_SYNP7/131-227 CLDVLIHYPESDAAAMLSHLCSLAEQRVLVSFAPKSPVLNVLKRIGQFFPGASKTTRAYQHSETAIAASLSA----NGFPKCNVGPSTKHPSILLLLEAVR
Q8GE43_HELMO/132-228 SMDVVIHYPLSDMPKLLGHILSLTKERAYISFAPSTAWFRFLKMIGERMSGSSRTTSAYLHPMTDIERILNE----LGYEITREKLVSNIIYNSMLLEIKP
Q93SV3_CHLTE/135-231 CFDVLIHYPAEGFAHAFSNLAGLTKGPIIFTYAPFNNILAFQHWIGGFFPKKERRTTIQMIKDKEMQRVLSE----LGLKIVSQQKISFGFYHTMLMHVAR
Q8RTV9_9PROT/80-180 AMDSLIHYESEDGLRTLAAMAETVTTSIVFTFAPKTPLLAAMHSVGQLFPRGNRSPAIAPMALSQLQRAVASQPEFTEWEMARDFRVSRGFYISHAMELTR
Q8KZ59_9PROT/132-232 AMDSIIHYAAKDGLKTLETLASTVNASMVFTFAPKTIPLAAMHAIGKLFPRSDRAPAIEPIAPHNLRRSITTSEALLDWQVSRERRVSTGFYTSQAMELVK
Q9L8J4_RHORU/132-232 AMDSLIHYQAADTVQVLERLAARTSKTMVFTFAPRTPMLSVMHAVGKLFPRGDRAPAIQPLGEKSFRWKIVGEAGLADWSLGRTQRVKCGFYISQALELVR
Q9JPA6_RHOGE/132-232 AMDSVIHYDAPDAVAALSRLAERTSTSMVFTFAPRTALLSLMWTVGKLFPRGDRSPAIVPVAPEQLRSLMAAHPGLQGWQWGRSERISSGFYTSQATEWKR
Q8KYZ6_9PROT/128-221 AMDSLIYYSAEDIGATLDRVSSRILTNMVFTVAPRTPLLMAMWRIGKLFPRNDRSPMMVPHQMAQIAKSTSG-------QISDIDRVASGFYISQALEFRP
Q59780_RHOSH/129-222 AMDSLIYYTDADIAAALDRLGARTRHSVVFTVAPRTPFLMAFWTMGKLFPRSDRSPVMIPHPFQPLNEA-------TGGRLVKVGRVSRGFYISECLEFRP
BCHM_RHOCA/131-224 AMDSLIYYRAPDIGRVLTELGKRTHSAIVFTVAPKTAFLMAFWWLGKLFPRSNRSPVMIPHALDKLQRHAGD-------SLIKIDRVARGFYISECLEYRP