EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07071 alignment
(5 sequences with 223 aa)


Q8Y429_LISMO/12-220 WNNFALFNFLAKDKENSLEVMVAARGFAVPGIVATNYETAEEAANVVKELQTTAE-VISVGLGGGGDWQNWRDVLHIARLAPNSHINQPIETAGLTNGLL-----PETYTNALVRPTGKVGIVKLSSGD--------EITAEEAVDYCLSANIPSIKFMSIEGTKYLDELVYLTKIAADKGIYGIEPAGGIGADNILEITTAIKSTGIPFYMPHIFGKTIDKA
Q8ZL28_SALTY/7-227 YRQRVAINVLAKDIANAKAIYEAAEGHAVIGVLSAQFATVEEGVPEVKRWMAEVP-SISVGL-GAGDPAQYYKAAMIAAHTHPAHVNQTFTGSGFAAGALAATGGEQTHINALVSPTGTPGEVVISTGVSSSQGTPARVSCEAAVRMMQDMGAHAAKFFPMGGEKSLPELYALATTAARHGMTLIEPTGGISLDNFGIILQTCLEAGVPRVMPHVYSSIIDPQ
Q8ELL9_OCEIH/6-221 YNDRICLNVLASDITNAKEIYEATDGHVLIGLLSSNYTSVQEALEDIRVYDKVLDGSISLGL-GGGNPEQWKMVADISREYKPRHINQVFPKVGYTRAAV---NHAQTMINSLVKPTGQPGLVDIATGP--TNKSLIIVEVEAAIQLTKEMGGNSLKFFPMGGTSRLEEYEAVAKACAKEDFYL-EPTGGIDVQNSPQIIEIALQAGVKKVIPHVYSSIIDGS
Q8ZK42_SALTY/8-209 YRDRVCLNVLAGSKDNAREIYAAAEGHVLVGVLSKNYPDVASAVADMREYAALIDNALSVGL-GAGDPNQSAMVSEISRQVQPQHVNQVFTGVGTSRALL---GQNETVVNGLVSPTGTPGLVKISTGPLSSRAPDGIVPIETAIALLKDMGGSSVKYFPMGGLTCRDEYKAVA-----------EPAPAMISGWNRRAV------SIWKTSPRFCTSPLMQV
Q88ZQ6_LACPL/8-225 LPNGICLNVLANSVTNAEACYAAAEGHVVLGVLTKNYLSDESAITDMRRYQAAVNNAVSVGL-GAGSPQQSAMVARVAAEIQPQHVNQVFTGVATSRALL---GQADTVINGLVAPSGEVGLVNVATGPLSSQSAKANIPVATAITMLKDMGGTSLKYFPMQGTAHLEEFKAVAAACADNEFGL-EPTGGLDLTNFQQIVQIAVAAGVRQIIPHVYSSIIDAT