EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07047 alignment
(7 sequences with 137 aa)


OPA32_DROME/7-140 PAAKLGILAIKQVSKPIANVIKSNAKSSPFFRKYICMPPAQFYNWVEVKTKM--WALNMGGRVNVPPLNEAMAIELGANLLGEFIIFSIGAGLLIFEYSRQTIKENKKNELAQSEKM.ELTNMLTEMNFRLERQDAQ
Q8N784_HUMAN/7-139 PMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWLEMRTKM--RIMGFNAAA-IKPLNEGAAAELGAELLGEGIIFITACSCLMLEYWRHQLQQRRKEKERRVARE.ALRGEVGHLELALEELQAQ
Q8C6Z9_MOUSE/7-139 PMAKLFYLGIRQVSKPLANRIKDAARRSEFFKTYICLPPAQLYHWVEMRAKM--RIMGFRGTT-IKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQTQQRNKEEEQRAAWN.ALQDEVGRLALALEALQAQ
Q9SGP9_ARATH/4-136 PLMKLGTLAVKTISKPLASQLKHQAKVHPKFRQSI-INFAQRNHRITTQMQR--RIYGHATDVEIRPLDEEKAVQAAVDLIGEIFLFGVGGAVVVFEVQRSSRSEARKEEARKQELE.ELRIKDEELEKQVADLKSK
Q8S2P6_ORYSA/72-205 PVAKLGTLALRTLSKPIASRLKNQAAVHPKFRNFI-ICIAQINHRVTTRIQR--RIYGHATDVEITPLNEEKAVQAATDLIGEGFIFSVAVAALIFEVQRNARSEARKEEARKQELEvELKQREESLSKDLEDLKLR
Q9M2K1_ARATH/4-136 PLLKLGTLALRTICKPIANQLKKEAGVNPKFRQFI-INIAQANHRFTTKLQR--RASGRITDAVIRPLNEERAVQAAADLLGELFAFTVAGAALVYEVQRNARGEAKKEEKRQQELA.EFRRKHEKMENEIEEMKQR
Q8IKN8_PLAF7/3-137 PLFKIGIVLIRQVSKPISGYIKKKAIDNKNFKSIC-IYCGKKYYFFEQYIQKKFYNSNTTNINYSSYISENKSVNVGSEILGETIIFLVAALIIIAEYKRNSLKEAKKEFILNHKLE.TLKLQVLELQKENDEIMKI