EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07045 alignment
(16 sequences with 96 aa)


Q98G06_RHILO/23-115 TAYAIAHMrQVTMGPQIVEYLHKIDATLEPFGGRFLVHGGDVEVIEND.WPG-NLIVIEFPDRRHVREWYDSPAYQAILSLRTDNS.DSDVIIVDG
Q984S8_RHILO/2-94 PAYIISDV.TICDQEAFQTYRSRAAASIAHYGGRYLVRGGQVDTLEGE.WHPTPLIVVEFPDIEQARRWYASAEYAAALDVRDAAL.SRHLILVDG
Q89JB1_BRAJA/14-106 PAYVISEV.EVRDQAMMEAYRALAAQTIAQYGGRYLARGGAADVVEGG.PPPKTIIIVEFPTMARAREWYASVEYAEALKLRQTAL.ERRLMFVEG
Q98DD6_RHILO/3-94 KGYWIARV.DVRDAEGYKEYIAASKLAFERFGAKFLARGGAHELAEGP.GRA-RNVIIEFESLAVAHDCYHSPEYQRAVAIRQKVA.DGEIVLVEG
Q8FXW8_BRUSU/3-94 KAYWIARV.DVRDPERYKDYVSTAKPAFERFGANFIARGGKADAVEGP.GRA-RNVIIEFETMQHALDCYNSPEYQAAAAIRQTVA.DGEIVIVEG
Q8UIJ7_AGRT5/3-94 KGYWIAQV.DVRDSERYKDYVSTAKPAFERFGANFLARGGSVTELEGT.ARA-RNVVIEFPSVQHAIDCYNSPEYQAAAKIRQEVA.DAEMMIVEG
Q92SN9_RHIME/3-94 KGYWIARV.DIRDPERYKDYVTAATPAFEKYGATFLARGGQFHRLEGA.ART-RNVVIEFPSLQAAVDCYNSPEYQIAAAIRQEVA.DAEMVVVEG
Q882F9_PSESM/2-94 KAYWIAHV.DVTDPQQYSEYTQRAPAAFQLFGGKFLARGGRSEAIEGR.ATPQRTVIIEFESYEQAVACYHSPQYQNAMSHRQGAA.KAEIVIVEG
Q9LCS9_BRAJA/3-94 KGYWIGRV.DVNSDEGYKPYAVANGAIFKKWGGRFVVRGGKFTTVEGA.SRT-RNVVIEFPDYETAIACYNSPEYQANIKVRQPHS.VADLIIIEG
Q98CT4_RHILO/9-100 KGYWMVML.TVTDAEGYQRYREAIGDAISHFGGRYLVRGGEVTNPEGS.DFG-RHVVVEFDSYETALSCYRSQGYQTALQHRVAAS.TGHFAIVEG
Q8Y0B6_RALSO/3-95 AGYILASV.DVTDPVQYEQYKVLSTRAMQAHGAEPLVRGGKTEPLEGE.WNPTRVVVLKFKSYDAAKSFYDSEEYHAARDARAKAA.HVNMIVVEG
Q87W43_PSESM/6-99 SAYLIGKM.SITDQARYDNYKRLTPDIVKAHGGRFISRGGQKFLLEGE.AESRRVVIVEFPSVEAAQKFYNSEEYTKARHLREGAAdEMQLFIVEG
Q89X32_BRAJA/22-114 TVYAIAQL.KMTDRAAYDRYQARFFDVFRKYSGRLLAADEQPRVLEGT.WPYDKLVMMSFPDEAAFVAFSNSADYEDISRDRKAGA.QATVLLVKG
Q930M0_RHIME/2-93 SAYLIVDL.DIHDMKSIEDYRSKALPLVAKAGGKLIAIDESPLELEG-.WIATNMLIIEFPDKDAIRQLFASPEYAPLAAQRQAAA.ASRIIAING
O85836_SPHAR/2-93 AAYFIGSI.KSHDETWVAGYMAAVPALVGRHGGEMVCRSHEFVRYEGEgAAPDYVVVIRFPSMEAIDAFMNDPDYAPHKDARIACA.TSDIFAI--
Q89BY8_BRAJA/66-158 PAYFIVQN.TIKDEAQYQKYVQAVVPFIASFGGKLVARRAKVEVLEGE.HDQRPVVMFEFPDMEAIHAFWNSPDYVPIKKLREGIA.TMNIWAFPG