EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06993 alignment
(13 sequences with 124 aa)


Q9JVT5_NEIMA/3-122 LLFIPLVLFVAVEHFYIAWLEMTQIPSEKAAETFKLPYEFMEQNRVQTLFGNQGLYNGFLGIGLVWSRFAAPDNAVYGATVLFLG----FVLIAAAWGAFSSGNKGILVKQGLPAFLAAAAVLA
Q8Y9K9_LISMO/3-121 ILAFILTFIVMIEHIYIMILEMFFANTKLAAKTFGVEKELLANKKVQTLFANQGLYNGFLAAGLVWGLFFAGAGFAETVQIFFLS----CVVVAALFGGATS-SKGILVKQGLPAVLALVAVLL
Q88ZG4_LACPL/3-121 VAAMIMAILVAVEHLFILWLEMFNADSEMAAKAFGIPRQTLQSPSVQLLFKNQGLYNGFLAVGILYSLFVIPAVASAGATLFFLA----CVMVAAVYGSITV-SRAIVVIQGLPALIAFILMYF
Q98F54_RHILO/3-115 --GNILVGLVALIHVYIVYLEMVLWDTPRGHKAFRLTPEFAKASKV--LAANQGLYNGFLAAGLIWGLYLGAT--GFQVKVFFLL----CVAIAGLYGAATV-GRKILFIQTVPAVVALIAVWL
Q8U4U8_AGRT5/21-135 MIASILIAVVAAIHIYIVILEMLLWEKPAGRKAFGLSADFARQTKV--LAANQGLYNGFLAAGLIYGLTQGDE--GLSFKVFFLL----CVLVAGIFGAVTA-NMKILFIQALPALFALGFLWI
Q8P6U4_XANCP/3-115 IVAIVAGLCVALLHVYILVLEMVLWTRPLGLKTFRNTPEKAQATRV--LAANQGLYNGFLAAGLFWGALQART----DVLGFFLG----CVVVAGCYGAYSV-NRRIFFVQALPALIALALLWL
Q8XFH2_RALSO/4-119 NLALIAYLLVLLIHVYIVVLEMVLWKT-RGPKVFRITPEKAAETAA--MASNQGLYNGFLVAALVIGLVAPDPTIDAAFALFGLI----CVAVAGIWGGITV-NRRIVLVQTVPAVAALVLGWF
Q97NG8_STRPN/3-115 ---IILTTIVALEHFYIFYLESIATQSDATSRVFNMEKEELAHPSVSSLFKNQGIYKALLGVFLLYVIYFSQ---NLEIVTIFVL----FVIGAATYGSLTA-DKKIILKQGGSAILALISILL
YPAA_LACLA/3-119 ILTIILSLLVALEFFYIMYLETFATSSKTTSRVFNMGKEELERSSVQTLFKNQGIYNGLIGLGLIYAIFFSSA--QLEIVRLLLI----YIILVALYGSLTS-NKKIILTQGGLAILALISSFF
Q8DWT0_STRA5/3-118 TLTIIIATLTALEHFYIMYLETLATQSNMTGKIFSMSKEELSYLPVIKLFKNQGVYNGLIGLFLLYGLYISQ---NQEIVAVFLI----NVLLVAIYGALTV-DKKILLKQGGLPILALLTFLF
Q8DUJ8_STRMU/3-116 IIKMLIIILVALEFFYIMYLETLATQSTKTSQVFGMTQETLGEKEIDVLFKNQGIYNGLLGLGLLYGLAF-----NTAIILPILI----YIILVAAYGAYSS-NPKILLTQGGLAIIAALLYLF
Q8NY56_STAAW/3-119 IISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKDKNINLLLKNQGVYNGLIGILLIYGLFISSN--PKEICAAILV----YIIGVAIYGGLSS-NISIFFKQGTLPVLALISMLW
Q8NL72_CORGL/3-124 IIGAVFAILAVLLHVFIFYMESFAWTSEKARGVFGTTEIDAENTKE--MAYNQGFYNFFLAVIAGVGVAFLFAGSTGIGAALALAGTGSMLAAAAVLALSSPDKRGAAFKQGTFPLLAVVFLVI