EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06977 alignment
(13 sequences with 108 aa)


Q9RBW0_9PSED/171-275 ALTLALG-KEDNKGLEGLAYDLKGDRLFVTKERDPRQLLEVSGLRASLEGGVSLH.VRDMSNLVKDKVFATDLSSVVFDQQSGHLILLSDESKLLIEMTD.EGKVVSF
Q87TU0_PSESM/175-281 YIALVINPSLHNKGFEGVTYDPANDRLFAIKERDPRQLFEVSGVLRSIDQHRLQIkVVDRLDWITESVATRDLSDGHYDQRTGHLLLLSDQSRSITELDG.NGRFVSI
Q9I6G4_PSEAE/169-273 QLSLGIG-LNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADKPFAV.HVVDDPGRDKRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDT.DGEPVST
Q88CM9_PSEPK/151-255 QLTLGIG-LNGNKGFEGLAYDSAGKRLFVAKERDPMLIYEVHGFPHDNPEKPYAV.HVVQDRKRDSRLFVRDLSSLQFDERSGHLLALSDESRLVLELDV.QGQPLST
Q87UK6_PSESM/165-269 QLTLGLT-ASGNKGYEGLAYDSRGKRLFVARERDPVQIIEVRGFPRVNADAPGNL.QVITDGKRDGKLSVRDLSSLQFDEVSGHLLALSDESKRILELDT.TGRPIGS
Q9I294_PSEAE/158-261 KFSLG-SANKRNKGFEGLAYDPLRERLFVAREKAPVGIIEVNGFFNDRGEALDLS.-VGGDPQRDRGLFLTDLSSLYYDKASDHLLVLSDESRVVIELDR.AGDPLGS
Q9I6H2_PSEAE/177-275 EFPLG-NIGKKNKGFEGIAWDPRQQRLLLSKERDPMTLFSWK-----SDGGPSLS.-GAMTALPSDDLYMRNVSALSVDPRTGHTLVLSAESHLLLELDE.KGEPVSF
Q88CM8_PSEPK/166-263 SYDLG-PSVKSNKGFEAIAWDPLRQRLIIGEERPP-KLYTWNTDGRSPLK-----.-GEKQPLPSDELDLRNLSALGVDPRTGHLLVLSADSNMLLELDE.QGQQVSF
Q87UK5_PSESM/170-267 HYELG-TSANKNKGFEGVAWDPRRQQLLLGEERPPA-LYTWK-----SDGSNVLK.-GDKQSLLSRALDMRNLSSLSIDPRTGHMLALSADSHMLLEVDE.QGNQVSF
Q8Z1N0_SALTI/158-254 MVKLEGYDKAKNKGLEGTAWDAKNERLYAAKERKPIMIKEVE---MSKNG-----.-ITRALPSAITASVSDVSGLEYHAPTDSLLVLSDESKMILEVSS.EWRVRDR
O52120_ECOLI/130-228 KIQLE-KFNKKNRGFEGLAWKADDRMLFVAKERRPSKIFIYQ---LSSDLLSVKQ.-ATIPE-ALNDIRVNDISGLAFN--NESLMILSDESRKLLKFNLtEMSFIEM
YJIK_ECOLI/177-277 KIKIPLQDSPTNCGFEGLAYSRQDHTFWFFKEKNPIEVYKVNGLLSSNEL-----.HISKDEALQRQFTLDDVSGAEFNQQKNTLLVLSHESRALQEVTL.VGEVIGE
Q04816_SALTY/154-253 SLTLDVNRHSDNAGFEGLARGRGEHALMVAQEKKPLRLYVTD---RSPDALSMSD.-SLTHR-ASLPWFLKDISGLHYDRNNGLLYVLSHESAVVVVSGL.DGG-RKV