EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06967 alignment
(13 sequences with 84 aa)


Q8YLX6_ANASP/15-98 LLLQPIRQWLESLKIKNHRLARWLCTIIPASCPFEREFKWGDRILVHIPPLCKLNPFYEQLIEIRFKALMYLADECGEDVTQFC
Q8YLB2_ANASP/12-95 SLLNQLRYQLEVIEINDARIARFLCGLIPSHCPFERTVSILGRKVFQIPPLCKLNPFYEQIVLLRFKCLMYLADDCGEDVTKYC
Q8YYS3_ANASP/12-95 DLLYPIRQWLGGIEIHNSKLAHLLCKLIPAQCPFERDVNLFGRILFHIPPMCKLNPLYEEVVGLRFKALCYLADECGEDITVYC
Q8YQY3_ANASP/42-125 DILRPLRRYLDSIEVSDRLLAHRLCQLIPAQCPFERDINLFGKTLLHIPPLCKLNPLYEEVVSLRFRALCYLADECGEDVSQYC
Q8YWA2_ANASP/32-115 DPLQPLRQWIDALEIQNRKLAHFIAKLIPAQCPFERDIVVFGRIIAHIPPMCKLNPLYDQFVGLRFRALCYLVDKCGEDIQSYC
Q8DJ93_SYNEL/13-95 SILWPVRQWLEHLEVRDRQLAHRLCRLIPAQCPFERDIVV-AQWHIHIPPLCHLNPLYEELMLLRYRALCYLADECHEDISAYC
Q8YQT1_ANASP/141-224 EVLDPLRHWLDGLDIQDPRVARFLCKMIPPQCPFERDVTLFGRKIVHIPPLCKINPLYEQLVGLRFRALSYLADECKEDVSPYI
Q8DIL9_SYNEL/144-227 RLLDPVRHWLDGLEIKDAKVARFLCRLIPPQCPFERDIILFGRKIVHIPPLCKLNPLYDQLVGLRFRALTYLADECGEDITPYC
P73342_SYNY3/139-222 DLLHPVKDWLDGMAIHDPRLAHFICHLVPPQCPFERDVKLFGRKIVHIPPLCKLNPLYEQLIGLRFRALSYLADDCQEDITPYI
Q44487_ANAVA/12-94 DILSPLRRWVDQIQVCDRRTAHLICRLIPCCCPFERTLTLLGHTI-HIPPLCKLNPLYDEFIALRFRSLSYLSDECGEDITRYI
Q47920_FISSU/25-107 DLLRPLRRLVDSIQIKNYRLAHLICQIIPCCCPFQRDIHLFGRI-FHVPALCKLNPLYDNFVGLRFRALSYLSDECGEDVSKYI
Q44143_ANASP/25-107 DVLRPLRGWVDNFPVKNARFAHLVCQVIPCCCPFERDINLFGRTI-HIPAFCKLNPLYDEFVGLRFRALSYLADECGEDITKYI
Q8DHU3_SYNEL/20-103 SLITKIRQWLMTYPITTPAIAHRICRWIPAQCPFARTFSLFGRPVITIPPLCKLNPFYEEVVMLRLRALTYLSDVCQEDISQYV