EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06962 alignment
(19 sequences with 148 aa)


Q9Z6S2_CHLPN/53-191 RLVVYDIQKEALSNALLLFETH-.LSEqERSVIEMKEQSHEHILE-------KDVKLIHYNLGYLPKGNKEITTLARTTEISLEYALNIVRPDGLITVVCYPGHPEGEKETHSVESLAQRLHPKEWCVSSFYVANRCRAPRLFIFQRQ
Q9PL90_CHLMU/54-192 RLVVYDIQQEALDRAKNHFENHL.LIE.ERRIIEMKLCSHEYIQE---E----GAKLFHYNLGYLPNGDKQITTCRASTIASIQKALELVSPSGVVSIVCYPGHEEGAEELLCVDQLAVNLDPSKWEVCTHYSVNRKKAPRLFLFRKR
O84837_CHLTR/54-192 HLVVYDIQQEALDRATANFQSGL.LAE.ERAIIEMKLCSHEYLQE-------QGAKLFHYNLGYLPSGDKQITTCSESTVTSIYKALELVAPSGIVSVVCYPGHQEGAAELCCVEQVAADLDPSMWEVCTHYSVNRRNAPRLFLFRRR
Q9K7S4_BACHD/47-189 HVYGFDVQEQAIHQTNKRVKELG.FPE.---RVTLFHASHEQVATLIPPDQHPNIKAAIFNLGYLPGSDKTIVTKPESTITAIKKLLSIMPSGALIVLVIYHGHEEGKIEKTALESFVTDLEQTTAHVLRYEFINQVNDPPFIIAIEK
O34614_BACSU/47-188 HVYAFDIQESAVANTKERLGDMY.Q--.--ARTTLFHKSHDKIAESLPPETHGKVAAAVFNLGYLPGGDKSITTNGSSTIKAIEQLLSIMKDEGLIVLVVYHGHPEGKAEKNDVLEFCRDLDQQTARVLTYGFINQQNDPPFIVAIEK
Q99TA5_STAAM/46-185 HVYGFDIQDLALENTRDKVKDF-.---.--NHVSLIKDGHENIEHHINDAHKGHIDAAIFNLGYLPKGDKSIVTKPDTTIQAINSLLSLMSIEGIIVLVIYHGHSEGQIEKHALLDYLSTLDQKHAQVLQYQFLNQRNHAPFICAIEK
Q8CS36_STAEP/46-185 FVYGFDIQEQAILNTHKKTKDY-.---.--SNVKLIQSGHENAKLHIPAQHHGCIDAAIFNLGYLPKGNKEIVTKPETTIMAINEIFDILSIEGIIILVIYHGHEEGKVEKEALLEFLQNFDQNKAHILQYQFINQKNNAPFICAIEK
Q8EP11_OCEIH/52-190 HVYAFDIQQQAIQNTKQALEKYH.NNN.----VTLIHGSHALIEDYVQ---HDVIGGAIFNLGYLPRSDKSIITKPDSTIEAIQKILTKLKKDGIIVIVVYYGHDGGTSEKEAVLKHVANLDQKLYNVLQYGFVNQKNYPPFILAIQK
Q8Y6M2_LISMO/47-185 HVLGFDIQQLAIDATNTRLENAG.VSS.---QVELVCASHARIPEYTSK----PVRAAIFNLGYLPGGDKEITTTADSTLESIGHLMELLEVGGVIILVIYHGHPAGKQEKDAVMTFCEAIPQQDFHVLSYNFINQKNDAPFVIIIEK
Q88XB1_LACPL/56-196 HVDGFDIQSAAIEATTTALDKAA.LTH.---QVTLWQTGHEHIADKIAAD--QPIKCAVFNLGYLPGGDKQIITKPTTTLTAIKAIQERLVTNGLIILLVYAGHPGGATEAQAVLDYVTNLDQHQFQVLQYQFINQVHVPPYLLAIQK
Q9JV79_NEIMA/47-184 KVWAFDIQPQALNNTRCRLQEAG.YSN.----VRLILDGHENLKQYIPK----PLDAAIFNFGWLPGGDKSLTTRTETSIAALSAALSLLKENGMLIAVLYPGHENGKQEAEAIEQWAKNLPQEQFAVLRYSFTNRKNSPPYLLAFEK
Q8DQP3_STRR6/44-180 QVYAFDIQKQALEKTQERLHQAG.LTN.----AQLILQGHETLDQFVTK-----AKAGIFNLGYLPSADKSVITRPQTTIEALEKLCGLLVKGGRIAIMIYYGHEGGDLERDAVLDFVIQLNQQEYTAAIYRTLNQVNNPPFLVMIEK
Q8DYS3_STRA5/43-180 KVYAFDIQEEAIAKTKAKLTEQG.ISN.----AELILDGHENLEQYVHT----PLRAAIFNLGYLPSADKTVITKPHTTIKAIKNVLDILEVGGRLSLMVYYGHDGGKSEKDAVIAFVEQLPQNNFATMLYQPLNQVNTPPFLIMVEK
Q8P2C1_STRP3/43-180 KVYAFDVQEQAIRKTSERLAQLG.LSN.----AELILAGHEAVDQYVTE----PVRAAIFNLGYLPSADKSIITLPNTTLQALSKLLTLLMVGGRIAIMVYYGHDGGSLEKDALLDFVKQLDQRKVSAMLYQPLNQVNTPPFLIMLEK
Q8DSS3_STRMU/43-180 KVYAFDVQEQALIKTREKLEQLN.IKN.----VQLILDGHQTINKYVTE----PIRAAIFNLGYLPSADKSVITQPATTLTAIKKILERLEIGGRLAIMVYYGHEGGDKEKDAVLNFVKELDQQHFTVMLYQPLNQINTPPFLVMIEK
Q97G08_CLOAB/48-186 RVYAFDIQEKALLSTKRKLEASG.NIK.---IVKLIKDGHENLDKYIRE----NIKAAVFNLGYLPGESHIITTKSETTLEAVKKLLKLLYRNGVIIINIYHGHEEGRVEKEALYKLCSKLNQRKYNVFKAQFINQVNCPPELLVIER
Q898J2_CLOTE/53-190 KVYSFDIQMEALKSTEKKLYQNN.IHW.----AELILDGHENMDKYLKE----EPKIILFNLGYLPGNSKEVTTKKDTTLEAVKKSLDLIKKEGVIILVIYPGHEEGMLEKKALIDFCKGICQKQFNVIKLQFVNQINNPPMMICIEK
Q8XLG0_CLOPE/51-185 KVYAFDIQEEAVNSYKSKNKE--.---.---NVEVILDSHENFETYIKEE---NVDCIVYNLGYLPGNNKEVTTVAHSTLKSIEIGLDLLGDNGLMIIALYSGHEEGKKEKDAVLQFTSKLPKNKYGVLHTEFTNRAKSAPSLVVIEK
Q8GUP2_ARATH/129-272 YVYAMDIQKDAIESTSSLLDQAVgSKE.-KECVKLFNLCHSKMGEIVPE--NARVRMVAFNLGYLPGGNKSIITLSDTTLSALKAAERILKPGGLISLVVYIGHPGGREELEVVEAFGSGLPVSDWICCKFQMLNRPLAPVLVFMFKR