EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06891 alignment
(7 sequences with 131 aa)


Q9ZXL3_9CAUD/2-132 NKPDSLKAHLLAAVPELRNNGDRLVIFIDNGRVRSTSAESLSFEYAYDLQVILTDFAGHPDSVFLPLLGWLLVNQSDLLANLTKVQDGITFEADMLDRSKVDLGIVLQLTERVVVKRREDGRYDVSHPEEP
Q8P6I9_XANCP/2-131 IKPASLRAHLVAALPDLARDADRLLVFIDAGSLVSTFQPGLSFEYQYTLNLILTDYAGHPDSVMLPLLEWVQVNQSELLSNPARRGD-IAFEADILANDAVDLSIKLPLTERVVVTAKDGVGYDITHAPEP
Q8XY34_RALSO/2-131 MKPASLRDALTAGVPHLAANPDALHVFVDEGNVVGTGARSLSFEYRYTLTLIVTDYPDSSDTIVVPVLAWLRTNQPDLFANDERRHDGFRFEAEILNHCTVDLSIKLQLTERVTVKP-AGGGYQVEHHPEP
Q8FJH3_ECOL6/9-138 NKPQSLRHALNKAVPYVRNNPDKLHLFVDNGSLVATGASSMSWEYRYTLNAVIEDFSGDQNLLMAPVLLWLRDNQPDAINNPALREKLFTFEVDILRNDVCDISLNLQLTERVLVST-DGSVSSVEAVAEP
VPR_BPP2/2-131 LKPDSLRRALTDAVTVLKTNPDMLRIFVDNGSIASTLAASLSFEKRYTLNVIVTDFTGDFDLLIVPVLAWLRENQPDIMTTDEGQKKGFTFYADINNDSSFDISISLMLTERTLVSE-VDGALHVKNISEP
O80312_BP186/2-131 QKHKSLRKALINAVPQLRNNPDMLRLFADNGHTDSRLASSLSFEKVYVLNVVVTDFTGDLDLIFVPVQAWLREHQPDIMTTDDGREKGFTWIIDINNDDSLDISISLRLTERTLVKE-VGGALHVSYAPEP
Q48286_HAESO/2-131 LKAELIRSLLQSTSKDLNTNPDKLELFIDEGVVVSAGATSSSYELQYTLNIIVRDFNGSPNMIFAPIMDFIRENQPDLIHNPDKRKDGFRFIADHNNHDSIDLSIFLKLTERISVKE-ENGKNIITHLDEP