EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06871 alignment
(4 sequences with 209 aa)


Q44367_9RHIZ/1-206 MVDAALIKQCADPALKPAIVEQFIARAGSQDSLAITVRSGNRVVLVPKPTTSDEAMDLIRQNIGRNTIRVGITQYPAGLGILDAGQLKPDLVDACENIRMGTALFAKVWRIVMKWYGNPTAAAVLPQVMDDAIIAWQTGYFEGTAVFRAEDPGEGEVSQP---ATIQSDEAETKTGSRENAGDENPPSKAISSDPNKAGIRIDLSGIGA
O68015_9RHIZ/1-206 MVDSALIKECSDPGLKPAIVEQFIERAGAPDPLAVTVRSGNRIVLVPRPTTPDEALALIRQNLGRNIVRVGLTQYPAGLGIVEAGQLKPDLIEPCENIKMGTALFAKVYRIVTKWYGNPTESEVLPQVFEDAIIAWQTGYFEGTAVFRAADPGDVKLPEPD---PGVEAETSEAGSDKMKGGNVDTALEAEPADPNKAGIRIDLSGIGA
Y4DP_RHISN/1-199 MLDAALIKECADPSLKPAIVEQFVAAAGSTDPLAVSVESGGRLILVPKATSAGEAMAIVRQYVGQAVVRVGLTQFPVGVGVKNAADLQPDLVDACENLRKGTSMFAKVLRIVAKSYGNPESDDVIPQIFEDAVYAWKTGEFEGVSVFQAPDPGG-SVATEEVLRSDDRDSHTQDS------ASEWPEG---NDSVGSAAMRIDLSRIGG
Q9F5D7_AGRRH/1-201 MLDAALIKECADPSLKPAIVEQFVASAGSADPLAVTVKSGGRLILVPKAASADEAIAIVRQYAGQAVVRVGLTQFPAGVGVKEAADLKPDLVDACQNLRKGTAMFAKVLRIVAKWYGNPTSKDVFPQIFEDAIYAWKTGEFEGVSVFQAEDPGT-PV---EVPRSEERIPAEEES-AEPRPGEDAPET---VQEVGRAGIRIDLSRIGG