EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06859 alignment
(5 sequences with 112 aa)


Q9Y7L2_SCHPO/146-256 KFKIILALSVSKWVHLNNHDEGIIKFFGKISSLLETNGVLILEPQGWDSYLKAAKKISVFNQTPENLKIQPDAFEHLLNQAGL-VLEYSIEPQVNNSEYKNFAKRTMYIYKK
Q9LU61_ARATH/270-379 RYDTILCLSVTKWVHLNWGDDGLITLFSKIWRLLQPGGIFVMEPQPWKSYENNRRVSETTAMNYRTIVLRPDRFQEILLD-KIGFRTVEDLTSSLSGASKGF-DRQILAFQK
Q9VNH1_DROME/190-299 QFDVILCLSVTKWIHLNFCDSGLKQAFRRMYLQLRPGGKLILEPQSFDGYKRRKKLSEQIRDNYNAIKFRPDHFTEYLLSPEVGFAEMK-LMGIPEHCKVGF-KRPIQIFTK
Q8K3A9_MOUSE/550-659 EYDVVLCFSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYCKRKSLTETIYKNYFRIQLKPEQFSSYLTSPEVGFSSYE-LVATPNNTSRGF-QRPVYLFHK
Q9U2R0_CAEEL/256-364 EFDVILALSITKWIHLNWGDDGMRRFFRRAYAQLHPGGRLIIEPQAFDSYKKRAKMSEELKANYSKIEFKPEDFEMWLIET-VGFESVE-KLGVVGAKSKGF-ERPIDVYLK