EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06849 alignment
(17 sequences with 142 aa)


Q8TXS2_METKA/21-144 IATLGSHTALHILKGAKEEGLRSVVVCEEGR.TTPYERL-----.-------GVA--DEIIVVERFQDMLDEEVQERLRELNAIVVPHGSFVAYVGLDGIENEFCVPMFGNRRLLRWESERSLER--KLLKRAGVKVPKVFD
Y136_METJA/21-144 IATLGSHTSLHILKGAKLEGFSTVCITMKGR.DVPYKR-F----.-------KVA--DKFIYVDNFSDIKNEEIQEKLRELNSIVVPHGSFIAYCGLDNVENSFLVPMFGNRRILRWESERSLEG--KLLREAGLRVPKKYE
O27269_METTH/37-160 VATLGSHTSLHILNGAKQEGFKTAVVCEKGR.EVPYQR-F----.-------RVA--DEFIMVDKFSDIVNDDVQDELRSMNSIIVPHGSFVAYAGLDHIENDFYVPMFGNRDILRWESERDLER--KLMEEAGIRIPFKYT
O30123_ARCFU/22-142 IGTIGSHSALNILKGAKDEGFSTVCICRERE.KKVYES-F----.-------GVA--DKFVIVSDYSDLLDENIQEELRHLNTILIPHGSFNAYIGK--FDS-LLLPMFGNRELMIWETDRDRQR--EWLERSGVRMPKKYS
O59073_PYRHO/4-119 IATYASHSALQILKGAKDEGFGTIAFGKPRV.KLLYTKYF----.-------PVA--DY-FLEGDYP-------EDKLLELDAVVIPTGSFIAHLGVELVEK-MRVPYFGNKEVLKWESDRSLER--KWLEKAKLTLPRIYE
Q8U0R7_PYRFU/5-120 IATYASHSALQILKGAKDEGFETIAFGSSKV.KPLYTKYF----.-------PVA--DY-FIEEKYP-------EEELLNLNAVVVPTGSFVAHLGIELVEN-MKVPYFGNKRVLRWESDRNLER--KWLKKAGIRVPEVYE
Q8PWT3_METMA/21-143 IATVCSHSSLQIFDGARKEGFRTMGICVGKP.PKFYEA-F----.-------PRAKPDEYLIVESYEDIMN--KVEELRKKNVIIIPHGSFVAYLGTENFAE-MAVPTFGNRAVLEWESDRSKER--EWLLGAGIHMPGKID
Q8PT10_METMA/21-143 IATICSHSSLQIFDGARKEGFRTLGICVGKP.PKFYDA-F----.-------PRAKPDEYLVLEDYEDLIN--RAEELRKKNTIIIPHSSLIYYLGRENFTG-MAVPTFGNRTSIEWESDRDKES--RWFLGAGIQMPKKID
Q8PZA1_METMA/23-161 IGAIASHSGLDICDGAVEEDFRTLAVCQAGR.EKTYTEYFRAQRdHYGRIKRGIV--DETVVYKKYNEILLPQNQQKLVDEKVLFIPNRSFTSYCSIDEIEDNFRVPMVGSRNLLRSEERSEQQSYYWILEKAGLPFPEKIE
Q8U3N6_PYRFU/21-156 IGVIGSHSALDITDGAKEEGFPTLVVAQRGR.HKTYEKYFKLRK.TRDGLVKGFI--DEVIVLEKFSQIID--IQEELRKRNVIFIPNRSFVVYTGIDRVENEFLVPMFGTRSLLRTEERSEEKSYYWLLEKAKLPYPEEVK
O29983_ARCFU/15-142 IGIFGSHSAKEVGMAAKAWGFKTVIVVQRGR.DKLYTKY-----.-----NRHLY--DEVIMVEKFKDILNREIQEKLLELNTIFIPNRSFAVYVGYDGIEKEFEVPIYGNRFMLRAEERNHPKNQYYLLEKAGLRYPKEFK
Q980P6_SULSO/5-130 IAALASHSALDVFDGAKDEGFQTIGLCKKGR.ERPYLE-F----.------KAIM--DKCIILEDFKEIISDKVQSILLSENAIIVPNRSLAVYVGYDGIEK-MKTKVFGNRYMLRWEERIGEKNYYKILNEAKISIPKLFK
Q975Y8_SULTO/4-129 IAALASHSALDVFDGAKDENFETIALCKKGR.ERPYLE-F----.------KRIV--DECIILDDFKEIASEKIDSYLTSRDAIIIPNRSLAVYVGYDNLEK-MRTKYFGNRKMLRWEERTGEKNYYKILDEAKIRRPKIYK
Q8ZYV4_PYRAE/4-127 IAVLASHSALDVLDGAKEEGFRTIAVAKKGR.ERAYRE-F----.-------PVV--DKLIVLDDYKDIL--KIVDELRREDAVFVPNRSFAVYVGYDAIERQFPVPIFGNRYLLKWEERVGPFNYYRLLDEAGIRRPRTFR
Q980P7_SULSO/22-141 IATIGSHSALQILHGAKKEGFQTMVITDNKR.ENFYKN-F----.-------SFI--DNIYAYASLDEAVS--IINGI-KDYGILIPHGSLVEYLGKERVDK-IETKIFGNKKIFEWEADQKKKM--ELLRKSNIKIPEIFE
Q975Y9_SULTO/3-122 ILTIGSHSSLQILHGAKKEGFKTALVTPEKR.VKFYKQ-F----.-------TFI--DEVYGYKNEDEAVDYIND---FANNGILIPHGSLVEYIGPERVNK-IKTKIFGNRNLFEWEANQKKKM--SLLKSAKIKIPEQFE
Q8ZYV1_PYRAE/21-141 ISTVASHTALQILRGAKKYGFRTIAVARGEAvAQFYRQ-F----.-------PFI--DEVWV-GDFANFR--KTAEKLAANNAVFIPHGSYVEYVGWRQALE-APVPTLGCRELLRWEADQFKKM--SLLEKAGIPIPRIYK