EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06833 alignment
(9 sequences with 258 aa)


Q9Z449_PSEPU/6-260 NWLSGLAGGQA.LPGYPASLLVIDGELDNRLVRFIAVVPDAENPFPRARSGEVGLLEGWGLAKAVSEAVAADR-NGQKRAIVAVIDVPSQAYGRREEALGIHQALAGAVQAYAQARLAGHPVIGLLVGKAMSGAFLAHGYQAQRLIALDDAGVMVHAMGKAAAARITLRSVEQLEALAAEVPPMAYDLDNYASLGLLWRRLTVDNAEAPSSADIAQVRACLTEAVRDI-GSSTDLSSRLAGENRSASRQVREQLRRQW
Q9I6S6_PSEAE/11-268 AWFQALAGSLApRPGDPASLRVADAELDGYPVRFLAVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGRREEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHDPGVMVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTADLVRVRTCLGEALADILGGPRDLGGRLGAANREASARVRRLLREQW
Q87V58_PSESM/9-266 NWFNALSADASeVTGLPASLKVADGLLGEQPVRFVAVIADTNNRFPRARQGEVGLLEGWGLAKAVDDAIEQDRERAEKRALIAIVDVPSQAYGRREEALGIHQALAGAVDSYARARLAGHPVIGLLVGKAMSGAFLAHGYQANRLIALRDPGVMVHAMGKASAARVTQRSVDDLEKLAASIAPMAYDIDSYASLGLLWETLSVSQIEQPAVDDLTQVRQVLSSAIKDVQASGVDLSSRLGASNRKASAHVRQLLRAQW
O32714_KLEPN/10-266 LWLNKLAPDAPlMSGLCPSVQVADGQINGENVRFIAVVPDANNHYPRAAGGEVGLLEGWTLAKVVNETIAADADQPVKRPIVAVIDVPSQAYGRREEAFGIHQALAGAAGAYAKARLAGHPVIGLIVGKAMSGAFLAHGYQANRLIAFNDSGVLVHAMGKASAARITLRTVEALEKLAATIPPMAYDVSNYATLGLLSALLDINNPDAPDDHDLSLVSNTLRDAIADA-RTDASLKCRLGAENRRSSQLVRDRMRASW
Q93L25_BURCE/5-230 ALAEALFGR--.HHGMEADGDFLHGEPRF-DGQPLTVIGTTN-------HAPIGVELALAQARVVLDTV----AERPGQPILLLIDTQGQQLRRRDELLGINRAMAHLGACIDLARRSGHAVIALVYDQALSGGFITSGLIADACYALP--EAEIRVMRIPAMSRVTKLPEEMLTALSQSNPVFAPGVGNYIAMGGVRALWQGDLAAALRSALAQTGTE-------DR--------RACDGGERGGRTLAAGIAQRVL
Q8P4U4_XANCP/5-230 ALFDQLFPL--.GHAIACHDDVLTGSATT-AAGEVTVIGTAN-------KLEVGVDHALALAATVLAST----RTHPQRPIVMLADTAGQRLARGDELLGINGYFAHLAKSLDLARARGARLVTLVYGESVSGGFLSFGLMADHIHALP--DAQIRVMDLRAMARVTKQTVDTLQALSKSSPVFAPGVENYVRMGAVESLWDGDLAQALLDALATPSTG-------DQ--------RRTLGAERGGRTLARDVSAAVA
O54417_ACICA/5-236 LLLKQLFPK--.QLDYQINGYVIKGNAET-EAGPVRILGTVN-------AAPINQEIAIELAGEILQLI----QQQNKTPVVFIVDTQGQDLSRADELLCLNRTFAHLASCVDLLRRSGHANLAIIFGQAVSGGFLSYGLMANEVYALS--DSQVKVMDLNAMARVTKIPVEKLKDLSQSSAIFAPGVENFYKMGAINAIWPDLESDWISQALLNQQQQ-LESYITDQ--------RRVVGQQRQGRQLCNSVIEKVA
Q89XP1_BRAJA/5-233 DIIASLFPD--.GHEVSNDNGVLHGSATLRSGGTMLVIGIAN-------RTALGVDEAIRLSAHVLKSI-----GRDSGPILVLVDSDSQRMSKRDELLGLNEFLAHLAKVLIHADMNGRPTIGVLYGHSAAGALLATGLATRVLVGLP--GADPAVMDLPSMAKVTKLSMEALQEKAKSTPVFAPGLSNLAQMGAVHMTWS--NAASLADQLEALLADMPAA--QDR--------RDALGKQRGGRLKAAEIAERVR
Q89UY5_BRAJA/5-233 DILAGLFPN--.GRKIETTGAMIAGQATLPDGGPIHVLGITQ-------GQPLGVDEAIALAGRVIEII----KSNDRAPILVLVDSASQRMSKRDELLGLSEYLSHLAKALLLAEAEGHRTVGLLYGGSAAGAFIATALATGTLVALP--GAHPAVMDLPSMARVTKLPIEVLKAKAEATPVFAPGLDNMVRTGGIHVVWD--ETAPLAPQLAAVLAQ-PAG--RDE--------RSRLGAERGGRRKAAEIADRVV