EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06813 alignment
(15 sequences with 259 aa)


Q9ZUV4_ARATH/17-262 RWFMVFASFLIMACAGATYLFG.TYSKDIKSTLGYDQTTLNLLGFFKDLGANVGVLSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYFAIYGH---.DSKSLILLIAWLPAAVSLVFVYLIREK-------KVVRQRNELSVFYQFLYISIFLALFLMAMNIAEKQVHFSKAAYAASATICC.ALLFVPLTVSV
O80960_ARATH/21-266 RWFMFFGSLLIMSTAGATYMFG.IYSGDIKETLGYDQTTLNLLSFFKDLGANVGVLAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTERISKPQVWHMCLYICVGANSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGE---.DTKELILMIGWLPAIVSFAFLRTIRIM-------KVKRQTNELKVFYNFLYISLGLATFLMVVIIINKLSGFTQSEFGGSAAVVI.VLLLLPIIVVI
O81120_LOTJA/26-271 RWFMMLASFMIMAVSGASYMFS.LYSREIKFALGYDQSTLNLLSFFKDVGSNIGILSGLINEVTPPWVVLSMGAVLNFFGFFMIWLAVAKKIANPRVWHLCLYIVIGSNSHCFTNTAVMVTSVKNFPGIRGIVLGILGGYLSLSAIIITQLYYAFFIN---.DSQSMILIMACLPTATALILLPVIKNH-------KSIQQKNDSKVFYRFIYLVLALAGFLMIMIILQISFNFTQSEYYATTTVML.LLLTLPLAVVI
Q8S746_ORYSA/34-288 RWFMMLACMVIMSASGGTNIFS.IYSGALKSSLGYDQRTLNTLSFFKELGANAGIVSGLVAEVAPPSAVLAVGACMSLAGYLVVYLAVAGRVARPPLWLMCACISAGADSQAFANTGALVTCVKSFPESRGVVVGLLKGFAGLSGAVLPQLYLAIYGGGH-.DAGSLILLIAWLPAAISLVFLRVVRVMPHRPTNGRVGGGGSNGPIFSFLY-ISFAVASYLLVMIVLQKTISFSHAAYAATAIVLLlILLLLPLAVVI
Q9LUF8_ARATH/16-265 RWLVFVCAMWVQSVAGVGYLFGgSMSPAIKTSLGYNQKQIALLGVAKNLGDAIGFVSGALSEVSPSWVVLLVGATQNLFGYGVVWLVVTGQLPNLPLWMLFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPS---.HDSSVILMVALGPPVVVLALLFIVRPVERSC----RTNLRSDDLRFLAIYGFCVVLAVYLLGLLVLQSVFDMTQTIITTSGAILV.IFMVVPVLVPF
O81121_ARATH/16-263 RWLVFVAAMWIQSCAGIGYLFG.SISPVIKSSLNYNQKQLSRLGVAKDLGDSVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTGRAPILPLWAMCILIFVGNNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAILSQVYTMIHSS---.DRASLIFMVAVAPSVVVVPLMFFIRPVGG-----HRQIRSSDATSFTVIYAVCILLAAYLMAVMLVEDFIDLSHSIIIAFTVVLF.AILLVPIFIPI
Q9SLF1_ARATH/14-260 KWLGFVTAVWVQSISGNNYTFS.NYSGALKSLMNLNQLELNNLSVAKDVGKAFGILAGLASDRLPTPVILLIGCFEGLLGYGVQWLVVSRTIQPIPYWQMCIFLCMGGNSTTWMNTAVLVTCIRNFRRNRGPVSGILKGYVGLSTAIFTDLCTALFSN---.DPASFLVLLAVVPFAVCLTAVFFLREIPPAS---SAAEENEETRYFTIFNIVAVVVAVYLQSYDIIGIK---TGVFSVAFASILL.FLLASPIAIPF
Q9M8M1_ARATH/13-260 PWVGLAAAAWVQVSAGSGSTFP.LYSSALKSVLGFSQQQVTILGVACDLGENMGLLPGYASNKLPPWSMLLIGASSCFLGFGVLWLSVSQIVLGLPFWLLFVALALATNSNSWFGTASLVTNMRNFPMSRGPVAGLLKGYIGISGAAFTVLFSMVLHH---.SAMDLLLFLTVGIPVICLTVMYFIRPC-----IPATGEDPSEPMYFAFLLVTSILFAAYLVVTTVLSEVFILPSILKYVLVAIMV.LLLLSPLAVPI
Q8H6R3_9ROSI/13-260 PWVGLAAAVWVEIAAGNAYNFP.LYSPALKSVMGYNQQQLTILGVANDIGESVGLLPGIACNKFPPWAVLLVGVVLCFLGYGVIWLTVSQTITGLPYWVLWIALVVATNSNAWFGTAVLVTNMRNFPLSRGTVAGILKGYAGIAAAIYTVLYNMVLQN---.SATTLLLFLALGIPLICLVTTYFIRAC-----TPASGEDSSEHGHFVFTQAASVFLAIYVVAISITSDYVSLSDALSYILVAIMV.VFMLSPLAIPV
Q8H613_ORYSA/14-261 PWVGLGAAVWVQVAGGASSTFA.LYSHALKVALAADQRRLALLGVACDVGENLGLLPGVLCNRLHPALLLLVGAAACLLGYGSTWLAVSASGPALPYWLIWFALCLAANSGAWLGTAVLVTNMRNFPLSRGAVAGILKGYAGLSAAVYTVIYTGVLHD---.SASNFLLFVTLGVPVVCLVTMYFVRPCE-----PSLVENSSEQVHFLFTQLSSVLLGVYLVAATILDHFVTLTDAVNYVLLVIMV.LVLFVPLTVPL
Q9SS92_ARATH/41-290 RWTVLVAAIWIQAFTGTNFDFS.AYSSDMKSSMGVSQSRLNYMAVASDLGKALGWSSGFAIAYFPVSGVLFAAAAMGLVGYGVQWLSIADVID-LPYSLVLVCCSLAGLSICWFNTVSFILCIRHFKANHSLALSLVVSFNGISAALYTLGHEAISGKS-SaSSDIYLLLNSLIPLIVSVLALWPVLTNPNSSET-DTTRTHDETRIFVVFNVLALVTCFYLLLPS--SGTYLASSPRWHFLGAI--.FLLLFPLCVPF
Q9C862_ARATH/7-251 KWTVLVAAIWIQASTGTNFDFS.AYSSHLKSVLGISQVRLNYLAVASDLGKAFGWSSGIALGYFPLSVVLFAAAAMGFVGYGVQWLVITNIIT-LPYSLVFLCCLLAGLSICWFNTACFILCIRHFPNNRALALSLTVSFNGISAALYSLAFNAINPSS-S.--NLYLLLNSLVPLVVSFAALYPVLTKPSLDTTPDYDSRRHDSHVFTILNVLAVITSFHLLL-----SSSSTSSARLNFIGAV--.VLLVFPLCAPL
Q8H132_ARATH/7-253 KWMILVATIWIQAFTGTNFDFS.AYSSDLKSVLGISQVQLNYLAVASDLGKVFGWSSGLALMYFPLWTVLFAAAFMGFVGYGVQWLVITHFIS-LPYIMVFLCCLLAGLSICWFNTVCFVLCISNFPANRSLALSLTVSFNGVSAALYTLAYNAINPTS-P.--ELYLLLNALIPLIVSFTAIIPILRQPPFEPLPPDGVRR-DSLMFLLLNILAALNGVYLLLFG--SNSSDLTSARLLFGGAI--.LLLVFPLCIPG
Q94D97_ORYSA/8-252 HWLSLVGSIWLQTINGPNSDFP.VYSSQLKELKSISQVQLNFLAFASDAGKLFGWFSGVAALYLPLWVVAFVGAAFGLVGYGIQYMFLDSS--GLRYWHLFLLTALAGNGICWINTVSYLLCINNFASNSRVAVSLATSYLGLSAKVYTSLAETFPGLANS.KTKTYLLLNAVVPLFVTVMVAPSLRVFDL------KSAAASSDAAFLVMFAITLATGACAVVGSIGSTANGLSSKEHMISLGV--.-LLATPILIPV
O22926_ARATH/7-235 PWLSLVAILWLQSFNGTNLSFP.AYSSQLKELLKISQFKLNYLSFASDAGKVLGFISGIAAVYLPLPLVLLAGGSLGFAGYGLQYLSIIKKI------------------ICWINTACYIVAINSFPVNRQVAVGITASYQGLSGKIYTDMVHSFFHTSQReEASGYLLLNSLVPLVACLVTAPMLMRHGGD---KTMSYSKDVKVGFIVLFVLTIATGIYAVATSLV--------SVPAVLVLVGIaLFLLAPLAIPI