EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06804 alignment
(6 sequences with 342 aa)


Q9KQ48_VIBCH/7-337 LVLGSLAVLVLSACSSSPTQRRQAKDDFDYLETTEFKPWVLP----QGATPQFYPNYDIPQGAFHGGVGNVVDIRPPQQVLELIPGARAER.QNGEVTLWMLRQDEAQ-KVWDTALKMIAERKIPLRKQTDSM--VETDWVDWVSEDEDVTIGSRYLMSMVETNNRYGFKISLIGWRENGQVQTVSTTNKERYNAFMTNLVTTRYDSDVRAEAARRAQELVKQIPITMGSDRSGFPVIIARTPYDVLWQRLPELLPKMGFTIEERNQSQGTVKAKYAAPDDEFWQQVGVKP---IELKSGTYTFLFGDLGNRTSINVTDSAGKPVNEALLKEMVPVLSAVVD
Q8DBA9_VIBVU/7-337 LVLSSLAVFVLSACSGSATQRRQAKDDFAYLETPPLEQWQLP----EGATPQFYPNYNIPQGEFAGGIGKQVDIRPPQQILELIPGARYER.SQGEVTLWLIKQEEAD-EVWQTVKDMLAERQIPIDMQSDTH--IETGWVTWRSEDEEMEIGSRYAIDRFEANNRHGFKINLVDWREGTELKPVTLTNKERYNVFMTNLVTSQYDQVKRDEAQRRAQELVKQIPITMGTDRSGFPVIIARTPYNVLWQRLPTILPQMGFTIDERNQSQGTIKAKYASPDDEFWNEIGVKP---MELKSGTYTFLFGDLGNRTSINVTDSSGKPVEEAFLKSMAPVLAAVVK
Q87MI3_VIBPA/7-338 LVLSSLAVFVLTACSGGANQRRQAKDDFEYLNTPALEAWNVP----QGAQPQFYPNYDIPQGNYAGGLGKSVDIRPPQQVLELIPGARLDRsSNGEVTLWLLRKDELD-KVWQTVQGMVEARKIPVESQTDSR--IETGWVTWNSPDEELEIGSRYEISRAEANGRHGFKVSLIDWREGDQVKEVTATNRERYNVFMTNLVTARYDQEVREEAQRKAQELVKQIPVTMGKDRSGLPVIIARAQYNVLWQRLPNILPKMGFTIEERSQSQGTVTAKYASPDDEFWNEIGVKP---IDLKAGKYTFLLGDLGNRTSINITDPSGKPVEEEFLKSLVPVLGAVVK
Q8D0Y2_YERPE/13-345 KVVGVSLVMLLAACSTDQRYKRQVSGDESYLTAPGLKPLNAP---SGMILPVQNGEFDVRTVNSQGAVGKQLDIRPPVQPLTLLSGSRAEN.-ATDTSKLLLENSPQNRDLWAQVTRVLQDHNWPIASRQDASQTLTTDWIKWNRADEDVQFEGRYQISVQEQGYQLALVVKSLELQQ-GGKTITQYSEIQRYNSAMLNAIIEGLDKVRADSESSQASRKVGTLDVQSGSDDTGLPLLIVRAPYAVVWERLPAALEKVGMKVTDRSRPQGTVSVTSKSLSSSSWDALGAKD---PELPEGDYKLQVGDLDNRSSLQFIGPKGHTLTQAQNDALVAVFQAAFS
NLPB_ECOLI/12-343 KVAGVSLVLLLAACSSDSRYKRQVSGDEAYLEAAPLAELHAP---AGMILPVTSGDYAIPVTNGSGAVGKALDIRPPAQPLALVSGARTQF.-TGDTASLLVENGRGN-TLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQ-AGKPVADAASMQRYSTEMMNVISAGLDKSATDAANAAQNRASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSDSDWQELGASD---PGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFS
Q9CLZ8_PASMU/4-336 WLFPFAFVATLAGCSVSNESKQQAND--TYQKSDAALPLFAPLNTAGVSLPKQDTTYQLPQVKVKKA--DQVDIRPPETPLAIIQNSIAQF.-DGERALIAYPIDKREVYNLQQVARLLKEQGIGYQLTNEK---IVTDWAPTGRADEIGDTQVRYEIEQVSSGNYSALFVSILQMKRNEVVFSPHLADKQRYSSDRLNQLVGELDASYRKQVRDLNNSGLMPIQSVLGTDSNGRTALVLGAPFNHAWTKLGQVLPQLEFDIKDEIIGRGVRELKYRPAGAKSWWWPFGRAEGSSGLKTGTYFMQLSALGKQSAVVMTDDDGNALSGEQAQALYQALQNLLA