EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06783 alignment
(2 sequences with 86 aa)


MANBL_HUMAN/1-85 MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR-
U239_DROER/6-87 DSLAAAASLDKYGDEDIFSLLIRYGLYVGALFQFVCISAAVLME----NNPDVNSNPETGEVTEREGEPVRTRLHKIRKLEKKKRR