EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06770 alignment
(8 sequences with 211 aa)


Q9YMK9_NPVLD/1-194 MLEAALGVNLVCAGAAFVGLGVAGARSSAAALLVDF-EDGTDVFDMSADVAVYGALLTAAGALAL---------LSLVPRCRRASACLAMGALLLSISMTMAWLFGLTWLVRYGRVPALDARLRTYDTDRLCWDGLVFAP---PAALNMK---NCFARD-GRVMCALCRSEYYASEATALRKYRTVVALGAIVAFLAQGALLLVLFLAETK
Q9J8A1_9NUCL/6-200 LSCIARSILTLVVGVAFAILGIAGISESSYALIIDY-ANGSPVFNCSGFVLVYG--VNLVIVGGG------ILFTDKLHCLQYLLVCLTLLASHATLTVIVLICT-YNWVVEYGHIPALDAYVREHDRKSVCWNGIVRL---DYNSLAFD--TNCYRIA-ETTYCALCRKEYYSDEMTFLKLNRFELAFVLVLLLTLNGYTLWKLHEIYTS
Q8JMB0_9NUCL/49-236 LSCIVLSTTLNVIGCIAVTIGCMGMINPNAALIIDY-ENGTGMFNCSGFVFVYG--VLLICVGLG---------IVFLPKLPWHLAT----TLLCLIIIVCLCT--LSWIVRYGHVAILDVHVREHDVSASCWGGVYVN---DFNNIQVPQ-TNCFFAG-SKMYCVRCRNEYYRDEPTFVRTYRFTIVFVMLALLALNAWSFAVSYKKYIA
Q8V5P8_9NUCL/7-202 LQLIFFSVLG--IGCTLF--GMYGIFDTDWAVQLDYGLVSVAPYNCSNLLCAYGFMLCLACIFSV---------ITSKVNSTWPLVFAFYFTLLCAIIVMCLLTM-LEMFVQHGHIGALDVHYRNYDIDKTCWKGIVEYKQVDSNSIVVDMPLNCYEIK-YQIFCASCRNVYKPYEATFFKNHRITVYIALGTIFTWHCLCLIQLLNKYVR
Q9J1I8_NPVST/7-198 TVHLILIVFMLATASLCVAFGILGVIDERFEPTLDY-ENGYGAQTVVYLMLAYGSLLALVTVVGS--------IGYFSRIKRFMHVAVPIAVFLAVLQISMFMS--IASVSQHLHLPIVDAAYRDHDKDSVCWTGLERRK--FINDSNAN---NCCVRK---MMCVECRSEYVCDETTFAKQHYWTLFVLAAISVMANFLFIQNMFDRLCR
Q91GN2_NPVEP/25-222 TVHIVVFVFS-LMGTVNQKYALLLELNDG-VSVLNISLLTAFMWGPYVLIAITYYMYKIILYFKK----------LSMKCDFYIKSVIIVVNVLALICWLLFVIF-QPQIYQHGHVPVLDVMYREYDLDSLCWSNVYVEKYDAHDTNAIVTDRNCVYQHNFIKKCIGCRIEVQHDEPTVFNQNPSALIMMTLTIIIIFCWNMYVQQKEMRT
Y021_NPVOP/19-217 GLCSFAFVFA-LMATVTARYAFLLELEDSAHSIINLSHLAAFLLGPYVLATITWAMYKMLLCYKG----------LEMRSNFYMKTVVALAHLMAGSCWLLFVVF-QPQIHKNGHVPVLDALIRHHDRQSLCWSGVVVQEYEVHDANAIRTDLNCVYYDNFMKKCVGCRMEVRHDEPTVFNQNQGALTMLALLAIVMHCWNMYVQQKETRR
O92388_NPVBM/19-223 LAYLIVFVLS-IMGVADNRYAFLLEIEGK-RSVINLSIPIMLSFGMWILFYTFYFVWKIVVWTKNRIGSSNTNVNFNAEKNFYVAITCIMVNVITGLCWMLFAAF-QIYVFKNGHLPTLDVLYRHYDLESVCWNSIVYLEIDYENAEILS--QNCVYEN-LYKKCIMCRAIVRDHEPTVFNQNYSVIIMGVLTILAVQCWNLYVQLKEMRR