EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06732 alignment
(9 sequences with 298 aa)


Q9VL96_DROME/4-287 PKKYESGEATQYISRRAALRKLQLSLNDFRRLCILKGVYPREPKH-RRRAQKGSSEIKVLYHTKDIRFLLHESIVWTLRDYKIFAKKSNRDR-AIKDFRNLKRRLAL--FPEIKLDHIVKERYPTFIDALKDLDDCLTLLFLFSTFPSLHL----------IPREQSNLCRRLTIEFLHYVIASKSLRKVFISIKGYYFQAEIKGQKVTWIVPHYYPFKPQSRQEVDFKVMSIFVEFYTIMLGFTNFRLFHGLNLAYPPQFPSSVLQDSEESLKDEASFVSDRIAALNFELLRTDKVQ
Q95Y89_CAEEL/6-287 KQKYTAGAAVAYMSRKQALKKLQLTLKDFRRLCIIKGIYPHEPAH-KKQANKGSTANKVFYYRKDINFLAHEPIINKFRDYKVFLRKLNHLK-AKKEEDKLKKLYEN--KPVYSLDTIVKERFPTFGSALRDMDDALSLCFTFAMLPHTRV----------LKEGMIDSCRKLTAEFMHYVIESQSLRNTFISIKGIYYQAEVHGEKITWVVPH--ERGLPHVTDVDFTVLVTFVEFYIAMLGFVNFKLYQDIGLFYPPQIGQVVKTDEMETEEYKEKVYSLAKPLAKRKDVEQAEDD
PESC_BRARE/6-287 KKKYESGSATNYITRNKARKKLSLSLADFRRLCILKGIYPHEPKH-KKKVNKGSTAARTYYLLKDIRFLLHEPIVGKFREYKIFVRKLRKAY-GKAEWSAVERLKEN--KPGYKLDHIIKERYPTFIDALRDVDDALSMCFLFSTFARTGK----------CHVQTIQLCRRLSVEWMNYIISSRSLRKVFLSIKGIYYQAEVLGQTITWIVPY--QFAHNHPTDVDYRVMATFTELYTTLLGFVNFRLYQTLNLVYPPKLDGQGEISLKAEFEEDYALESESYTEKLSALSASLARM
PESC_HUMAN/6-287 KKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKH-KKKVNKGSTAARTFYLIKDIRFLLHEPIVNKFREYKVFVRKLRKAY-GKSEWNTVERLKDN--KPNYKLDHIIKERYPTFIDALRDLDDALSMCFLFSTFPRTGK----------CHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIVWITPY--AFSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVV
PESC_SCHPO/5-286 KQKGKAGAARIYITRNQALKKLQLTLADFRRICILKGVYPREPKN-KKKANKGSTAPVTFYYTKDIQYLLHEPIVQKFREYKVFARKLSKAL-GKGELETAKRLEAR--KPTYSLDHIIKERYPTFHDALKDIDDALSMLFLFSTMPVTDK----------IGAATVANCERLCAEFQHYVIRSNSLRKAFLSIKGIYYQAEIFGEQITWIVPY--KFAQSVPTDVDFRIMHTFLEFYQALMGFVNFKLYNTLGLRYPPKIDVAKSESAAGLAAYELEESSSLPAIVHGNNKNARKNI
PESC_YEAST/4-285 KKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRN-KKKANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRAL-GRGEVSSAKRLEEN--RDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPSTNQ----------VSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWLVPF--KFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDLKKDKIISGLSSYILESRQEDSLLKLDPTEIEEDVK
Q9LYK7_ARATH/8-286 TGKKKEGNAARYMTRSQALKHLQVNLNLFRRLCIVKGIFPREPKK-KIKGNH-----HTYYHVKDIAFLMHEPLLEKFREIKTYQKKVKKAK-AKKNEELARLLLTR--QPTYKLDRLIRERYPTFIDALRDLDDCLTMVHLFAVLPASDRE--------NLEVKRVHNCRRLTHEWQAYISRSHALRKVFVSVKGIYYQAEIEGQKITWLTPH--AIQQVFTNDVDFGVLLTFLEFYETLLAFINFKLYHSLNVKYPPILDSRLEALAADLYALSRYIDASSRGMAVEPKVDASFSS
Q8IIS5_PLAF7/7-292 KKKIKKKKEGKYLTKKHILRKLFLNEEEFRKLCIFKGIYPKDFKEIPLKYRKKFYKHKVFYTRNDFLKLSHEKIINDFRKIKIYLKKYKKCKLTLEDFTRSKNIVAN--FPVYKLEHIIKERYPILSYAVDHLDDALSCIIAYSQLPSNHKY--------GIKNNMVKTCEMLKDHFHYYVYKTNRIKKAFISVKGYYLQAEILKKKVTWIIPH--IFTPYLDTSIDFKLISDFIEYYIALLKFVLFKLYKLDNMLYPPKQDNDLKNEKLAHLSYDKDYSTNENNIDINMNQELQSKC
O97209_LEIMA/11-301 RVKKER-FKKKFLTRMQATRLLQMESVQFRRLCILKGIYPRALNR-SKQKQSGN--EKQYYLAREIKWLVRDQIAEKMMAYRAWEKKVKRAE-AMGRSEDLKVLQTSRVKPRHSLVATIKERYPYFIDAIRDVDDAMSMIHLYAFLSPEIKSDTTIEIHHSLTSGLSERAKEVCERWDRYVARARVLTKGFISIKGYYYEAIVKGERVRWLCPH--EYAHRFPPGIQQYVMLSFLEFYLEMMKFVLFKLESDLARDEADRLAAEDEEGVTRANAEDFANGAALAVLDVGANQAQAKAV