EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06730 alignment
(3 sequences with 271 aa)


Q9VK91_DROME/1-264 MFRRGKLSFLNTKDDRVKIINERINITERHLMEMCSSFALVTRKMAKYRDSFDELAKSVKSYADDEEINESLCQGLKSFTNAVTIMGDYMDINVHRLEHKIVNELAQFEQLCKSTRDNLRLAVIARDKEVLRQRQMLELKSKFSANN---SAADSELFKAKMEVQRTNKEIDDIIGNFEQRKLRDLKQIISDFILIAMKQHTKALEILSASYYDIGTIDERDDFIEFQKLM----KTKEELASRKTALKKGLRSQSMDSLEHEHLVSPLKR
Q8N8R1_HUMAN/1-261 MMRRT----LENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATETPHLKL--GLMNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSDRHVISQAETGLQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLERWSFAM----LPRLVLNSWGSSDPPALASQSVRFSEILCMHQIIHL
Q8BP22_MOUSE/70-334 MLRRN----LDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYASTETPNLKQ--GLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNREAKQLSQLERTRQRNPSDRHVISQAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSLYLSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQISTCRT