EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06713 alignment
(8 sequences with 114 aa)


Q8ETD0_OCEIH/30-139 LIPVIIFPFNWLILIILVG-VFVLSTLFILLPCFNLCYIFFYDYLLVKSGFFRFHIKYSQMTKIEATSNFLIGTRAMMATNG--IVIYYSSGIT-GELKLSPDDQDAFLKILQE
Q8EQJ6_OCEIH/24-123 IAPLLNGQWFASLLMIIIG-LFLL------WFWFRTGYRIDNDKILIYYGPVKQTVKIKDIEVIFKTKFPLTSP--ALSFDR--MQIKS--GKY-DIVTISPEEKESFLQQLMD
Q9K9B1_BACHD/14-114 IPPIVEQSVILLIVLLSIV-IFLL------SIWFRTYDRIDGDRLFAISGPFRWSIPIQDIRSIEKRKNLLSGP--SLSLDR--LTILY--GVGYDIIVISPEKEDVFLQLLLD
Q8CV26_OCEIH/33-133 IIAFSASNFIEGLVGFIIV-VLLI------WAWFSTGYQIVNDIVKVKAGPFKKTINIQEINKISKRKSVWTAA--ALATDR--LVIQY--GKYNLDILVSPRNESDFIKLLLS
Q9KEX6_BACHD/37-136 LPSFFDTYPVRLTFFYTIA-GLLL------WIWFRTGYTVTEDWLVIEYGPFKKKVEIETIESIRETKNPFIDP--ALSMNK--LQLYY--GNS-RHIAISPQEKEHFKKQLVK
Q8ELH5_OCEIH/28-127 QSIYVEVDIVAIFVMAALI-LLLG------SIWFNTRYRIDNNTLRISYGPMKWSININEIKSIRKTTNLFVGP--CLSVHR--LEIHY--GNY-KVIQISPKRMQLFIKEIQK
Q99IS9_9ZZZZ/33-132 STGTPTAWVVAAFI-TLVGVGLPL------WLLLSTRYVLGQGQLRVLSGPFKWCIPVAKITTIAPTSSPLSSP--ALSLDR--LRVDY--GVG-NSVMISPRNKEQFVKDIEA
YYAB_BACSU/31-134 VLGNMRVSGWIIFILLTLLNGLII------WSFIDLKYVLKEHHLIIKAGLIKHQIPYENIDKVVQKKKLWSGF--RLIRSRHAITIYYQGG--WGHAVISPQKSEEFIHKLKE