EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06703 alignment
(5 sequences with 185 aa)


SPC25_CAEEL/3-180 DEPVKVVNKWDGPTVKNALDEVVKKILN-DKVGWTESHNLMNLRLLISFIGVAFSAFACGYDYYEPFPKSKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDG---KQSRKWAWSSEIKAHDDKYTLSAEF--KKE-GRSGQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ
SPC25_DROME/12-191 EELVKV-NKWDGSAVKHALDDAVKTCLLGDRPQLKEQFGLVNTRLALCALAVSVAIMAHAWDFTHPFPESRPVLLFSVLAYFALLGILTLHSSFREKGTFAVALQKDK---ERERLWEASSDMRKYDDKYLLTLSVRDTKN-GKRREQSSNKSCAAFIDQNGIVLDNLVANEVNRLFNALAADKK
SPC25_CANFA/43-224 DKPVKI-DKWDGSAVKNSLDDSAKKVLL-EKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT-KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLATERK
SPC25_ARATH/10-188 NKNVKKANLLDHHSIKHILDESVSDIVT-SR-GYKEDVRLSNLKLILGTIIIVVALVAQFYN--KKFPENRDFLIGCIALYVVLNAVLQLILYTKEKNAILFTYPPEG--SFTSTGLVVSSKLPRFSDQYTLTIDSADPKSISAGKSVQLTKSVTQWFTKDGVLVEGLFWKDVEALIKNYAEEEP
YMF5_YEAST/1-177 MSSAKPINVYSIPELNQALDEALPSVFA--RLNYERSYALLDAKLYIGYSIAVVAGLSFFLDKKFERDQIVTYQKLLVGAYFVLSLLFWYFSRFIEKGTVYVGKRRGT-----KEEIYVKTKFEKNEPLYLVELVQKKKGE-NSKKELKAKLEVNKVFNESGYLQNDAYFKWFSEQHNVLDTKKN