EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06672 alignment
(3 sequences with 211 aa)


Y8E0_PSEAE/6-212 AFGLALLLLASGVARGEPAVTLDPQQSQVFRAWFVRIAQEQLRQGPSPRWHQQDCAGLVRFAANEALKVHDGKWLRANGL----SNRYLPPELALSPEQRRLAQNWQQGGGQVGPYVNAIKLVQFNSRLVGRDLNQARPGDLMFYDQGDDQHLMIWMGRSIAYHTGSSTPTDNGMRSVSLQQLMTWKDTRWIPDESNPNFIGIYRLAFLSQ
YFAT_ECOLI/1-207 MRHGLLALICWLCCVVAHSEMLNVEQSGLFRAWFVRIAQEQLRQGPSPRWYQQDCAGLVRFAANETLKVHDSKWLKSNGL----SSQYLPPEMTLTPEQRQLAQNWNQGNGKTGPYVTAINLIQYNSQFIGQDINQALPGDMIFFDQGDAQHLMVWMGRYVIYHTGSATKTDNGMRAVSLQQLMTWKDTRWIPNDSNPNFIGIYRLNFLAR
Q8XV01_RALSO/31-241 FAPGVRALSGWADAAAAGPGALTPEQSGVFRAWFVRIVNEQLRQGPTPRWTHRDCAGLVRFAAAEALRPHDVRWLRANGMRDAESARQLPPELDLTPAQRTLAQRWARIDGSTGAYVSALALIQQNSRFIAKDVNQALPGDLLFFDQGDDQHLMIWMDRYIAYHTGTVTRTDAGLRAVPVSELMQWKDSRWQPQGGNPNFIGVFRLAFLTR