EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06645 alignment
(6 sequences with 81 aa)


SPC12_ARATH/1-80 MDWQGQKLVEQLMQILLVISGVVAVVVGYTTESFRTMMLIYAGGVVLTTLVTVPNWP-FYNLHPLKWLDPSEAEKHPKPEV
Q8ILC7_PLAF7/23-99 MDYCGQNLAYTIRNIIFGISTIISIIVGYYSQSLALSTYIILGGTALASILILPTWP-MYNRNNIEWE---KSYSSSNDKK
SPC12_MOUSE/12-89 MDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWP-IYRRHPLKWL-PVQ-DLGTEDKK
SPC12_DROME/8-83 MDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLITIPPWP-LYRRNALKWQ---K-PIDTDAKS
SPC12_CAEEL/19-98 IDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVLGASAFTALIILPPWPFLFRKNPIVWHTPAE-PQESGDKK
SPC1_YEAST/16-94 IDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISCVITLICVLPAYP-WYNKQKLRWAQP-KIEINVDQYD