EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06588 alignment
(4 sequences with 205 aa)


Q8MR83_DROME/44-241 LSERLNFEIYRYSSYSPNYLPENVLVDCPNDQTSRWSAYT------NSPPQFLTLKLRRPAIVKKIKFGKFEKSHVCNIKKFRVYGGLDDEHMVLLLEGGLKNDNVPEVFNLRCLTEDGS-ENLPILYLKIVPLLSWGPSFNFSIWYVELHGQDDPMYTSARMKNYNSLREVEIIKLCLKHFRQQGYLSAFGALQEQTNVQLEHP
MKLN1_MOUSE/12-207 ECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSES------NYPPQYLILKLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDE---QMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHNYTEAFESLQKKTKIALEHP
YDOA_SCHPO/2-206 ERKELSYTIQSWSSYSGAFHPINILIDNPHQANSRWSCNTSICKPNNSEEQYVILKLDKLALVTDITFGKFHTPHLCNLKDFIVYGGREQHLMFPLLRAGLTNDSNRETFPLCIKKYNKIENSIACKYIKIVPLQAHAHEFNMSIWYVALHGIDSASALSCTEKNRALHLEKKALNCLLSYFAFKGKLDICSVILQSYQLSIPHS
Q8SWD6_ENCCU/7-197 LYSVIPYEIHSYSTYASVYVPNNIKRNDPMDPNSRWSTST------NDHLQYIVLKVPTSLVV-TITFGKYNKMHVSNVKKMRISVSRDGVEYREVLCGGLKNDSEMETFNLLVKD----EIYFIAQYVKIEPLAAWGVNFSYSLWFVELRGLVD---VEEFVRYNEMVVFGRSMRNCLRFLRDCGFRDIYEILEKRSSDKIEDE