EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06576 alignment
(2 sequences with 176 aa)


Q8Z611_SALTI/1-176 MIYPTNTGKSGEHLRLTTLESVWIQGKLRMWGRWSYIGGGKTGNMFNQLLTSKKLTKTAINEALRRMKKAGLDKPELEAFLRDMINGKQKSWLVHCTDAEALCIDRVISEVLAEHPGLICILRQRYEGRGMTKRKMAELLNDAHPEWCFRTCCSRVDVWLNLAEYMLYLPMRDAFS
Q8XC85_ECO57/5-180 MIYPEITGKSGEHLRLNTLEAVWIQGKLRMWGRWSYIGGGKSGNMFNRLLVSKKLTKTAVNEVLRSMKKSGLEKPELEAFFRDMTRGKQKSWLSHCTDTEALIIDRVISEVLGEYPGLINILRQRYEGRGMSKRKMAECLNRTHPEWCFSTCEKRIAGWLAVAEHMLYVPMHDSFR