EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06570 alignment
(7 sequences with 223 aa)


Q9CJ13_LACLA/3-212 NLIEELTAKNKEYIHSVTKQLILVGKSDEEVKEILNDILPQIIEGQKSGIIARKLLG-APTEFVTQYQPKVADR--PVSEKNENPVLMWLDSSLLFLGFISLLNGVTALITSK-AP-----VYGLITTILSAAVAGLVMYMMYRYFYRPKA---DNSRRTWNWKGFAATTLSVLLWIAVTIFSGL-LPTSVNLQLPAIALVIVGLVAFGVRWLLKRQFNIQSA
Q8NZJ1_STRP3/1-212 MELQELTKKNQEFIHTATNKLIQDGKSDEDIKLILEEAIPAILENQKKGVTARNLLG-TPTAWAASFSQDPSQRA-AETDKNTNPWLMWLDTSLLFIGIVALLNGIMTFFNTN-AT-----VTGLISLLALGFGGGASMYATYYFIYRHLG--KDKSLRPSWFKIIAALSLAMLIWIALYSATAF-LPTSLNPQLPPLALLIIGGVSLALRYYLQRKYNIQNT
Q8DXY5_STRA5/1-213 MTLQDLTKKNQEFVHIATNQLLADGKSDAEIKAILEEHLPEIIDNQKKGITARSLLG-APTTWAASFTERPEDKARVSVQKNTNPWLMWLDTSLLFLGLVTALNGLMLLFGQS-NV-----NTGLISILTLGFGGGAAMYVTYYYIYRHMG--KPKSERPGWLKSFAVLALVMLVWFALFAVVPL-LPATINPKLPEVVLFIIALASFGLRFYLQRKYNIQSS
Q8DSE2_STRMU/1-213 MDVQNLTKKNQEFINIVTHQLLQSGKSDEDIQTILAKTLPEIIEKQKQGIPARSFLG-APTAWAAQFIETEQNKSTASAPKNTNPWLMWLDTSLFFLAVVTLITGFLNFFSKQ-AP-----TYGIVTLTFLGFGGGAIMFLTYHFFYRYSG--MPKNERPSFIKSFGILAFFMIFWMFLYAATGF-LPAFLNPKVPGFVLLVICALAFGIRYLLKKKYNIENA
Q8CZ91_STRR6/11-225 IDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIFEEVIPQILEEQSKGTTARSLYG-APTHWAHSFTVK-EQYEKEHPKENDDPKLMIMDSALFITSLFALVSALTTFFAADQAF-----GYGLITLLLVGLVGGFAFYLMYYFVYQYYGPDMDRSQRPPFWKSVLVILASMFLWLLVFFATSF-LPASLNPVLDPLPLAIIGAALLALRFYLKKRLNIRSV
Q8Y3R6_LISMO/14-220 ELKANLTKRNLQYVMEVEKHLRETHYGEEQQEIIVYEMSEKILAEQKKGITARKLFNLTPTEYVVSLDVK-----AATVEQNTDKWWLVLDGGLLVLGAMMLISGISAYFQKN-AQ-----TLGIIVLLITAVVGGFAMLILRKYA-----SNMRAGQKGGTIKYLLVAVGVIAVWMFVMTIVQVTIPPNINVALSPIVNTVGGAIIIALRFYVKKKKNIPSL
Q88T15_LACPL/28-239 HEATELTKRNAEYMRQMRKSLDATALSGEKKTAVLNEMTSTLLAEQGRGTTARQLYG-TVQERTEEIV---NPKKTPVERQKANYWVTALDNGLMLFMIFCLMYGIMGFIGTN-ATKNSAGANGITAILITSAIGGLGVAKLFEYL-----MPAKDGKKVSLWKKIAWSVLAIIVWMLVFTTMSM-IQGPLNPVLPGIAYLIIAVVVFFARMWLKRRFNITTS