EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06560 alignment
(5 sequences with 190 aa)


GPI2_RHIME/27-194 VKTFRDLAGLYRDESAYQALIATRGDDVAYEVTDYKPSANGGD------IIIGVTRMEPGKIGDEYFMTRGHIHAR-----PNRPEMYYGEAGVGVMLLES-PHG----------EIRTIEMRARTMCYVPPFWIHRSVNVGLEPLVMTFSYPADAGQDYDVIAKAGGMRTVLSMTGTVDGPQSITPVIQ
GPI1_RHIME/27-194 QKRFRDLAGLYADEAAFSAMQETWNDTVVYEVSEFRPNERTGD------LIFGVTRMLPGKVGEEYFVTRGHIHKQ-----SDRPEIYYGQKGRGLMLLES-PEG----------EVRVVAVDAQTVCYVPPYWIHRSVNIGGDELVMLFCYPADSGQDYDCIAKAGGMRARIIDDGRGGWKQIDNPNWR
Q8ZMP7_SALTY/31-215 GRKSAGQMAVVLPE-----FTEGLRNEPAYDVYRGLSFAEDQERLAADQYQYDITIIMPGTIGKERKKTSGHYHGYNDTRRNTHPEVYEVIKGTAAYILQKSPDFAAAPQELVVDDLIVAVVKEGQSIIVPPNYGHCSINIGDGPLVFSNLAYKPCTVHYDTVQFYHGMACYIVEENGQLCVRKNHYYPR
Q8PVJ5_METMA/16-196 VRKLHDMEDVVFDREWFEKTDE-MNRDMYYMFRDLARSDSDLEIIKSRHLRYDITRIPPGMLGSEYIKTVGHYHPQVPGTDVSYPEIYQVLEGSATYLLQK-VEP---GEEEIVLDVAVIKAEKGDLVLVPPGYGHVTINSSENTLEMANWVCGDFSSFYEPIKRLSGAAYFLLKDG----FAKNPLYRN
O28778_ARCFU/14-189 VRKASDLKPVLAFPEALKE-----DFDAYYMFRDSFKTDEEAEIIRNAGLRYDYTVIPPNNIGGESIKTYGHYHPEVV-RGFTYPEVYQVLEGEALFILQK-PSN------GKIEDVIVVEGKKWDTVIIPPNYGHVTINPTESDLITANWVCRNFSSIYEPYTKRRGACYYYI-NGEWVRNRNYDDAPE