EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06556 alignment
(2 sequences with 131 aa)


IAPL_ASFM1/94-224 ATLGIIGLKKMIDSYNDYYNNEVFVKHKNRVYTHKRLEDMGFSKPFMQFILANAFIPPYRKYIHKIILNDRYFTFKFAAHLLSFHKVNLDNQTTYCMTCGIEPIKKDENFCNACKTLNYKHYKTLNFSVKL
IAPL_ASFM2/108-238 ATLGIIGLKKMIDSYNDYFTNEVSVKHKNRVYTHKRLEDMGFSKSFMRFILANAFMPPYRKYIHKIILNERYFTFKFVAYLLSFHKVNLDNQITYCMTCGIEQINKDENFCNACKPLNYKHYKILNFSVKL