EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06501 alignment
(3 sequences with 439 aa)


V55B_HHV7J/5-430 TSDILKYVQIEIPYKEEFQGKDNVTLLFDEYVQSKTEPVLLLSAE-INSRNSDSFFSARPLMEEQQLKLHLKNLNRHIYPSKVLFFGFPLLKINSSIVIIP--------NHDVKEQEQMGVFPSLIRFKNEKVIVTQTPHKVNEITVTMFNIEWKLSTYQRSIERTPGHPLTTLCTVCSVNINNLPFWFHDVRSGSDFPTCKVFSISDPTVSVLKMIFSPPLLEIYLRCYTEVTKNNTYMVPNDCMLKLGFVNEIIPNEISLTVHMHYFKICSDKRKIDVFFQDTMLFDEGETKKLHFKGTFYNFNANALYVPDPNSKVQSIASFWSPTTSFTTKVTSDRSQRVTTNDIIGSIYFIPTHILRTKFDPNYTDSFAAEIELNSEDPESDALYFLADKIFISDLPDLILRKGWSARKKKLQSGSNIN----NHAPSKSRLRF
VU55_HHV6U/3-432 SPQLNHVLQLVFDCNH-IVSN-SYQEIILKCRISSTKPGILFITDGTESETEDVLFDVQFLEKTTTIKIKILPISRTV-PVRIHLFSIPIYLPSHALEIDDINALCQKENIDPTVYEQYGLTNMPISTTNVINQFKVVQNDSVEMSLILFNLNWTESPYQSQKLDRYGRKLLIVFSVFSIDTRECPYWENLFK--SIIPLCRVNMISEPGISIYKIEFNDPFLTVFLRNVVLPENKRRFPITKECYLRLTF-SPPDRSTVTLNMNMPYFKICADGKNLEVFFPNDMSLVSNTNKEITLRGEFTNKKIVGIFIPVQTHVFKLYPFLWFAQEPLKLRISCERTVSVTEHDMLGRVFFVTKKLFRKPFRSLSNSDMKSLLTHTENTDKPFDVHFMGNCFPAYLLPELTLHPL---EYEDKPARGNPQTLPSVEKHSIIKIRI
O56289_9BETA/6-427 VSELSQLIQFTVDFND-LQPELNFSPAEITCILSHERPVLLLITDGTENNAECVTLVGHVLKNKKVIKINVFPMIQSI-NF-VNIFALPIFNITSSLLIQDNCYF--KENMDPLRFHQFAYLEKGLGTTPII--LYSVKNGDLIVNATVTKITWEKNEFQPLLKNSNDQRLETMYCIFTFNTTYCKYWNVFFA--SATPICNVEMISEHNVSVYKIEYRSPVLFVFLR--YLKVMNSRFCVD-ECSLRLRF-SKPNMQSVALNICMPYFNISEEFKTMEIYFPERMTLTPNHITQINLRGTFENPAAVGLFIPKKSNVLS-FPFIWQPRETFRIYVYCRNETFVTEHDIIGHVYFISREQFPHSFHPTAHADCKSKVEAAFNS---FRINFLGNDFFSDSLPILTVHPMTDFPYEQIQETENIRHNSMNITPRFKRMQL