EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06500 alignment
(5 sequences with 416 aa)


Y2276_VIBCH/4-414 ASSKNLSETLFQNHKQAKETSSLTQYMPSSL--ELLDTRREQSSQAWYRNLRRLQWIWQGVDPVEQEEILARIASSKHSRTHDEWLDTVMGYRSGNWTYEWTRVGMLHQKQAAERQGE-EAADQMFAAALYYSIAGYPHLRNDNLALQAQVLANNAYQEAAKLTGFVVKRLEFSYQN-KKIAGYLHLRN-TDSPKPVVLVSAGLDSLQTDMWRLFRDYLAKRDIAMLTIDMPSLGASSHWPLTEDSSCLHQAVLNQLADLPWVDHFRIGLIGFRFGGNAMARLAFLESDKVKACVSLGAPIHDIFTSPNKLAAMPKMYLDVLASRLGKNVVDVRSLSGQLMAWSLKVQGFMSGRRTKTPILALGLEGDPVSPYSDNQLVALFSQGGQAKKVKSKTISQGYEQSLDLAINWLEDELC
Y328_VIBVU/4-414 EVSKNLSETLFVKHKQAKETSALTQYMPTSQ--SLLDEIKEKNGFSWYRNLRRLQWVWQGVDPIEQEQVLARIASSKHSRTDEQWLDTVMGYHSGNWAYEWTRLGMEHQKRAGEMTNE-AASEALFSASLCYSIAGYPHLKSDNLAIQAQVLANSAYLEAAKKSKYIIKQLEIPFEK-GKITAHLHLTN-TDKPHPVVIVSAGLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYPLTEDYSRLHQAVLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKIKACVILGAPIHDIFASPQKLQQMPKMYLDVLASRLGKSVVDIYSLSGQMAAWSLKVQGFLSSRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGYEQSLDLAIKWLEDELL
Y674_VIBPA/4-414 DVSKNLSETLFVKHKQAKETSALTQYMPTSK--KILDDREQQEDRAWYRHLRRLQWAWQGLSPIEMEGVLSRIASSTHSRTHDDWLDTVMGYHSGNWTFEWIKLGMEHQRRANDLKGE-DAADELFTASLCFSIAGYPHLKNDNLALQAQVLANKAYSEGAEKTQYTIKQIEVPYQK-RKIIANLHLPR-TDKQLPVVMVSAGLDSLQTDMWRLFRNHFAPKDIAMLTVDMPSVGHSSHWPLTEDSSCLHQAVLNELYSIPYVDHHKVGLVGFRFGGNAMVRLSFLEQEKIKACVALGAPVHDLFTSPKKLQKMPKMYLDMLASRLGKSAVDINSMAGQMMAWSLKVQGFLSSRKTKVPILALSLEGDPVSPYSDNQLVALFSHYGQAKKISSKTITKGYEQSLDLAIKWLEDELL
YAFA_ECOLI/1-414 MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIPHWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQAMVWQQKACAEDDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQRLPGTMRQMEFTVPGGAPITGFLHMPK-GDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRGIAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVRLAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELNRYSLKVQGLL-GRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFDKGLQEITDWIEKRLC
Y3224_YERPE/1-415 MAQANLSEILFKPKFKHPETSTLVRRTHCNHVVNIHSALDGDTANHWYRMINRLMWTWRGIDPLEIEEVLSRIACSKAEHSNNELLDTVVGYRNGNWIYEWANQGMMWQQKAMEETDPGSAGQFWLNAANLYSIASYPHLKGDELSEQAEVLSNRAYEEAAKYLPYTLKELTFPISDGGSLSGFLHMPTVGSAPFPTVLMCGGLDTLQSDYHRLFRDYLEPKGIAMLTIDLPSVGASSRWKLTQDTSYLHQQVLQALADVPWVDHQRVSVFGFRFGANVAVRLGYLEPQRVRAVACLGPIVHHLLCNSDSLRKVPDMYMDVMASRLGMADSTDETLNTEMNRYSLKTQGLL-GRRCQTPMLAGFWENDPFSPKEEAKLICSSSADGKLLAIPSKPLYENFHRALLQTSEWLEDKMR