EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06483 alignment
(7 sequences with 196 aa)


Q9ZIX4_9GAMM/793-980 EYFMGSTMTSLAYNKFAQAGSKYDINKGEKTHQVPAEAVDVSFEVKDFPIGDDNYPIAPTFSFTNNSNIDLS-GAKVSFDVPVATSAIFKSNWNAQEKLGMAVDVNRSNAAGNN--IGGFENEFHRFSITFVNEWGGAAKSFAPGETINAQVMYYMPITGPVN-LVFEKDGKQYAAKFEYP---YLPDATAGNG.G
Q8VLQ3_ALTSO/788-976 EYFMGSSLTSLAYNKFNQSGTPYSVKQGNKTFVKPASAVDVTFVAKDFPAGDANYPIAPTFAFTNNSAIDLS-GAKISFDVPVATSAIFKSNWNAQEKLGMAVDVNGSNAAGNN--IGGFENEFHRFSITLVNEWGGTPKSFAPGETINAQVMYYMPISGPVN-FVVEKDGNRYAFSSEYS---DLPIATPGTGpT
Q9RMB8_ARTSP/642-818 QYEMGSTLVNKIHSTL-SASKPYGATKAN--VKMPTKAIDLGVELKNFALGDNNYPINPEAHFTNNSKTTIPAGATITFDSAASDTG------EMKEQSGWTITKDSSDHTGSN--VGGLKGDFHTYTIKV-----PA-GGIAPGATVSTKLAWTLPTSMISN-FRVSIGSEQYALLTDYPRGVSVVEPSAGTG.G
Q9L3E8_STROI/540-717 QYEPGSTLTTAMYEKF-KSATPYGAKRTT--VDLPTEALDIGVDFGQFPLGDSNYPISPKLRITNNTKTTLPGGTEFRFDYGTSAPG------NAKDQSGWGTSVIRSDHTGGN--VGGLKGDYHRVSLKL-----PAWQSLAPGASAELDFVYYLPVSTPSN-WTVTFGGKTYALAGDLARGTTVVEPGGGTG.G
Q9L115_STRCO/540-717 QYEMGDTLTSLMYDTF-RSAAPYGAKKSD--ADLPVRAVDVDVEFTDFKLGDSNYPITPKLRITNNTRTALPGGTEFQFDYGTSAPG------NASDQSGFGTKVIHSDHTGGN--AGGLKGDFHRVSLKL-----PAWQSLAPGATVDLAFNYYLPVSTPSN-WTVTIGGTAYALAGDLARGTTVVDPGTQTP.T
CHID_VIBFU/804-981 EYHMGNTMTKAIYDKF-KAATPYGNTVAT--GAVPSETVDIAVSIGGFKVGDQNYPINPKVTFTNNTGVDIPGGTAFQFDIPVSAPD------NAKDQSGGGLSVIASGHTRAD-NIGGLDGTMHRVAFSL-----PAWKTLPAGDTYELDMVYYLPISGPAN-YSVNINGVDYAFKFEQP-DLPLADLSSGNG.G
Q9KT32_VIBCH/841-1021 EYVIGSDMTSYAHEVF-AAAKPMDIRHND--LPQPDSVIDVTVSTTEWPEGDSNYPINPKLVFTNHSNVAIPGGSTIEFLMPTSSGD------IVKDWSGAGLKVIESGHTGSNFSVNGEKKLFHKVAVTL-----RSTETIPAGGEYSVDMVYYTPVSGVANGVRFIVGNETVGLKKDFPTLPAFEGATDGGN.G