EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06460 alignment
(8 sequences with 316 aa)


R1AB_PEDV7/6481-6780 ASEWKCGYSMPSIYKIQRMCLEPCNLYNYGAGVKLPDGIMFNVVKYTQLCQYLNSTTMCVPHHMRVLHLGAGSDKGVAPGTAVLRRWL..........PLDAIIVDNDSVDYVSDADYSVTGDCSTLYLSDKFDLVISDMY----DGKIKSCDGENVSKEGFFPYI-NGVITEKLALGGTVAIKVTEFSW-NKKLYELIQKFEYWTMFCTSVNTSSSEAFLIGVHYLGDFASGAVIDGNTMHANYIFWRNSTIMTMSYNSVLDLSKFNCKHKATVVVNLKDSSISDVVLGLLKNGKLLVRNNDAICGFSNHLVNVN
R1AB_CVH22/6459-6758 SAEWKCGYSMPGIYKTQRMCLEPCNLYNYGAGLKLPSGIMFNVVKYTQLCQYFNSTTLCVPHNMRVLHLGAGSDYGVAPGTAVLKRWL..........PHDAIVVDNDVVDYVSDADFSVTGDCATVYLEDKFDLLISDMY----DGRTKAIDGENVSKEGFFTYI-NGFICEKLAIGGSIAIKVTEYSW-NKKLYELVQRFSFWTMFCTSVNTSSSEAFVVGINYLGDFAQGPFIDGNIIHANYVFWRNSTVMSLSYNSVLDLSKFNCKHKATVVVQLKDSDINEMVLSLVRSGKLLVRGNGKCLSFSNHLVSTK
R1AB_CVPFS/234-533 SAEWNPGYSMPTLYKIQRMCLERCNLYNYGAQVKLPDGITTNVVKYTQLCQYLNTTTLCVPHKMRVLHLGAAGASGVAPGSTVLRRWL..........PDDAILVDNDLRDYVSDADFSVTGDCTSLYIEDKFDLLVSDLY----DGSTKSIDGENTSKDGFFTYI-NGFIKEKLSLGGSVAIKITEFSW-NKDLYELIQRFEYWTVFCTSVNTSSSEGFLIGINYLGPYCDKAIVDGNIMHANYIFWRNSTIMALSHNSVLDTPKFKCRCNNALIVNLKEKELNEMVIGLLRKGKLLIRNNGKLLNFGNHFVNTP
R1AB_CVHSA/6777-7073 SQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWL..........PTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMY----DPRTKHVTKENDSKEGFFTYL-CGFIKQKLALGGSIAVKITEHSW-NADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGK--PKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVN-N
R1AB_CVBQ/6797-7054 ASDWKPGYSMPVLYKYLNSPMERVSLWNYGKPVTLPTGCMMNVAKYTQLCQYLNTTTLAVPVNTRVLHLGAGSEKGVAPGSAVLRQWLpagtilrqwlPAGTILVHNDLYPFVSDSVATYFGDCITLPFDCQWDLIISDMY---------DLLLDIGVHVVRCSYIHCHMIRDKLALGGSVAIKITEFSW-NAELYKLMGYFAFWTVFCTNANASSSEGFLIGINYLGK--PKVEIDGNVMHAIICF----GEI----------PQF-----GTGVLI-------------------------ACLIWLNSRLS--
R1AB_CVMA5/6879-7175 AADWKPGYVMPVLYKYLESPLERVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLAVPANMRVLHLGAGSDKGVAPGSAVLRQWL..........PAGSILVDNDVNPFVSDSVASYYGNCITLPFDCQWDLIISDMY----DPLTKNIGEYNVSKDGFFTYL-CHLIRDKLALGGSVAIKITEFSW-NAELYSLMGKFAFWTIFCTNVNASSSEGFLIGINWLNK--TRTEIDGKTMHANYLFWRNSTMWNGGAYSLFDMSKFPLKAAGTAVVSLKPDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVN-V
R1AB_IBVK/219-521 QSAWTCGYNMPELYKVQNCVMEPCNIPNYGVGITLPSGIMMNVAKYTQLCQYLSKTTVCVPHNMRVMHFGAGSDKGVAPGSTVLKQWL..........PEGTLLVDTDIVDYVSDAHVSVLSDCNKYKTEHKFDLVISDMYTDNDSKRKHGGVIANNGNDDVFIYL-SSFLRNNLALGGSFAVKLTETSW-HESLYDIAQDCAWWTMFCTAVNASSSEAFLIGVNYLGA-SVKVKVSGKTLHANYIFWRNCNYLQTSAYSIFDVAKFDLRLKATPVVNLKTEQKTDLVFNLIKCGKLLVRDVGNTSFTSDSFVCTM
R1AB_BEV/2033-2271 YYEW--------P-NILPQIESHYDLKNYGQNPTFMPQPV-NFAKYTQICTFIQD-HVKVARNALVWHLGAAGVDGCSPGDIVLSSFF..........-KECLVYSWDIKDY------STLLDKHSYDCNFRPNLIVSDIY-----------NVSSNVSEVLDDCV------HRLALGGTIVFKTTESSRPDIQLSQFTKYFSAVQFFTAGVNTSSSEVFVVLKYKLYSEPIGEELCSPNILSRIAAYRNKLCI-VPNFKVFSTS-FSYKYSGVKFVQ------------------------------KCFYVSVP