EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06433 alignment
(5 sequences with 343 aa)


DHMH_METME/64-404 DSKRVYVLDPGNFHMTSTVYTIDGKSSKLLGMTDAGKLPNVMVASDGKFLAIANTMYSRVARGKRDDYLELIDTKTHQPIADIDIPEG-RFLTGVFERTAGLSVDDKHLLFQQFSPSPGVGLVDLQQKAFVKIMNVPDCYHIFPTANQNFFMHCRDGSLMQFTYDSKGNTK-QKPTKIFHAEKEYLLNNPYYSNSNNHLTWPTYEGKIFQAKLSESGAEFLKPIEVFTDKEKADKWRPGGWQTIAFHKARNELYLLADQREKWTHKLPSRFVFVVDATSGKRLRRIELKHEINSIAVSQDDKPYLYAVSEEAKTLFTFDAVNGKALSSIDELGRAPSMIFIAD
DHMH_METFL/59-400 DAKRVYVLDPGHFHVTTTVYTIDGNKNNLLGMTDTGKLANVMLSSDGKFFVTSNTTYSRIARGKRDDYVEVIDAQSHKVLADIDIPEG-RFLTGVMNRMASLSTDNKYMLFQQFAPSPAVGLVDLEKKSFVKMMDIPDCYQIFPVPNQSFYMHCRDGSLQQFGYDDKGNLKPMKPTKVFHGEDDYLFVNPYYSNGSGRLVWPTYEGRIFQAKLTDKKVDFMKPFELFTEAEKKANWRPGGWQVVAYHKARNEIYVLADQRAKWTHVTASRYVFVVDGTTGKRLRRIDLGHEIDGISVTQDANPNLYAVSAEAKTLFTFNAVTGKETGKVDELGRAPTISLTMD
DHMH_PARDE/74-415 DARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPE-ITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRLLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTAD
DHMH_PARVE/83-423 DARRVYIQDPAHFAAITQQFVIDGSTGRILGMTDGGFLPHPVAAEDGSFFAQASTVFERIARGKRTDYVEVFDPVTFLPIADIELPDAPRFLVGTYQWMNALTPDNKNLLFYQFSPAPAVGVVDLEGKTFDRMLDVPDCYHIFPASPTVFYMNCRDGSLARVDFA-DGETK-VTNTEVFHTEDELLINHPAFSLRSGRLVWPTYTGKIFQADLTAEGATFRAPIEALTEAERADDWRPGGWQQTAYHRQSDRIYLLVDQRDEWKHKAASRFVVVLNAETGERINKIELGHEIDSINVSQDAEPLLYALSAGTQTLHIYDAATGEELRSVDQLGRGPQIITTHD
DHMH_METEX/69-410 NARRVFVYDPKHFAAISQFYMIDGDTARVVGTADGGFLSNPVVASDGSFFGQASTVYERIARGKRTDYVELLDPQTNNPIADIELPNSPRFLVGTYPWMTALTPNNKTLLFYQFSPQPAVGVVDLAGKKFDRMIEVPDCYHIFPSSNDTFFMHCRDGSLLKVGIGADGKSQ-TKRTEIFHKENEYLINHPAYSPKSGRLVWPTYTGKIFQIDLSSQDAKFLPAIEAFTDAEKKEGWAPGGWQQVAYHRESDRIFLLGDQRAASKHKAPSRFLFVIDAKTGKRINKIELKHEIDSVGVSQDAKPQLYALSTGDKALYIFDPETGKEVSSVNQLGAGPQVVMTSD