EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06414 alignment
(9 sequences with 230 aa)


Q9XAX4_PSEAC/34-260 LEQARHEKIYSQ-ISADYLSHVEAQESPRAIITGGQPGSGKGALARQAENAFAASGSCVSIDVDELRDYHPQYKELQRVNDREAANLVHPDASAWASQLIRDAAAARKNIVIDQTSKSPDALIDLTKQLKAAGYNIELRVMAVNSEISEQRIHTRYEKDKADNK-LARFVPPEVHFAGYIGLPESVAAVEREKAVDGLSIHDSNQVSIYEIKQI-DGEWDRQPEGKAVLE
Q8PRH5_XANAC/8-233 LSTRKHTAAYEK-IERHHFKDTAPADQPQAIILGGQPGAGKSGLLEASKQGF-ADRNVVTINGDELRYYHPQYRDIQKADERRFAELTDPHARPWTKQLFDRTIETRRNVVFEGTMREAGPITETMRRLKEAGYYVVARVIAANERDSMAGIHRRYEEQKAAK-GFGRWSNVQAHDDAYKGMPATLEYIEHNKLADRVQVYDRKGNVLYDNELQ-GNEWKRQPAAKTAIE
Q8P580_XANCP/24-239 EHRRLFEQKILD-DAA--LETKTSFEHPKAIILAGQPGSGKGSLARAADVEL--GRDVVLIDPDELRNAHPEVSALRNAHPYTWSGYTHSDASQWADELLQVTIEGKKNLIFDTTLSNGQWSAELIKDLQSRGYDVEVRAMAAHKLESEHGVDSRFSQQ-LDREGYGRYVPESHREVVYTRLPISLDTVHAQTT-APVRIFNRQGAEVYDSRTD-------ARPPGQALE
Q8DPX8_STRR6/6-225 YTDSEFKHALAR-NLRSLTRGKKSSKQPIAILLGGQSGAGKTTIHRIKQKEF--QGNIVIIDGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLGYNLLIEGTLRTIDVPKKTAQLLKNKGYEVQLALIATKPELSYLSTLIRYEELYIINPNQARATPKEHHDFIVNHLVDNTRKLEELAIFERIQIYQRDRSCVYDSKEN-------TTSAADVLQ
Q8E4Q8_STRA3/6-225 YSEAEFQKALRR-NIRALTRGKTISSTPKAVLLGGQSGAGKTTIHRIKQKEF--QGNIIIIDGDSFRSQHPNYLALQEEYGKYSVDYTKDFAGKMVEHLIGGLSKQSYHLLIEGTLRTTEVPRKTAQLLKSRGYQVSLALIATKPELSYLSTLIRYEELYAIDPNQARATPKEYHDGIVEHLVDNLRELENDKLFNRIQIYQRDRHCVYDSETD-------KGIAAEVLQ
ZTOX_STRPY/6-226 FTDKQFENRLND-NLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEET--QGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLET------PSISPKETLE
Q99Q13_STRCO/299-525 LSASEHRWIFDELIVPSYLGGLVGRDDPRAVYVLGQPGAGKLLAARMVRRAM--RPGTTRLVGDDFKASHPDYFQLLRDDPRSAGQAIRADYRAWFAQAEEYVRRRGGDVLIEAAPGSVDEFLSSALPFAASGYPVELVVLAVREADSRLATALRYARA-LQRGGTGRFTTRAGHDACFRALTDVVAVAERHPQITAVTVIRRDGQALMRSEAGGDGGRASRALAAERLR
Q99Q13_STRCO/3-229 SQQESLDVLHRT-ILPAALQSAVPQTRPVVVVVAGQPGAGKTAAADLVQAALDHRGGCVRIGRDLYKPAHRHYASALAADVRTAGALVRSDTAGWQAAVEDHVRAMGCDAVVESALADPDDFRLSSAAYRAAGHRIEVFALATPQALSQLGIVDRFLTETA--AGGGRYVPWENHDACATKMLDTLAVIEAEQLADRVTVVRRDGTVLYSNERTAGGGWRGRCAASQTVL
Q8DTS0_STRMU/6-196 YLDYS-KEHLDS-ILSDLFGNKQPSSKKDAIFMAGSPGAGKSEVAHLLADSY---KNMIVLDTDDFRCLFPDYDGSNSSNFQKACSW-------LTEQAFQYLTEKGYSFIYDTTFAVPSTEKKIKRVLKN-GYRPVIFYVYQEPKIAWQFTKDR-------ERVEGRKVPKETFINAFLHARENVEKVKVRHPETLVHLIIKD----YQNTIE---------------E