EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06397 alignment
(8 sequences with 36 aa)


Q9PJ99_CAMJE/1-36 MRQYETYKCQKCGNEVEVQNVGGGKLSCCGEEMKCI
DESR_DESGI/1-36 ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ
Q8TJP6_METAC/4-39 SRKGEKYRCEICGNEVVVTEVGGGTLVCCGEDMTLI
DESR_DESVM/1-36 PNMLEVYKCVHCGNIVEVMHAGGGDLVCCGEPMKFM
DESR_METTH/2-37 TETNQIFRCNVCGNIVEVLNPGAGQLVCCNQPMELL
DESR_DESBR/2-37 PERLQVYKCEVCGNIVEVLNGGIGELVCCNQDMKLM
DESR_ARCFU/2-37 TEVMQVYKCMVCGNIVEVVHAGRGQLVCCGQPMKLM
Q9FDN8_MOOTH/2-37 AAITQVYKCNICGNIVTILHPGGGALVCCGKPMELL