EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06384 alignment
(2 sequences with 81 aa)


Q9I902_XENLA/1-81 MNRDGAPGKTPEEMYIQQKVRVLLMLRKMGSNLTPSEEAFLRSYAGVVNSQLSQLPQHSLDQGAEDVVMAFSRSETEDRRQ
Q8K3C3_MOUSE/113-190 MDRDLMVGKLERELYTQRKVEILTALRKLGEKLTEDDETFLSANASAV---LSQFEKVSTELGSGDKVLALAGFDVEKAKK