EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06382 alignment
(2 sequences with 103 aa)


Q8T3U9_DROME/8-110 ECKSLWNGIISISAKDESPKGLTEMCNHPIRRVPQKCKPIKSCAKPRRKAACAKATRPKVKCAPRQKCSKQGPVTNNAYLNFVRSFRKKHCNLKPRELIAKAA
Q24402_DROME/8-110 ECKSLWNGIISISAKDESPKGLTEMCNHPKRRAPPKCKPMKSCAKPRRKRACAKATRPKVKCAPSQKCSKQGPVTNNAYLNFVRFFRKKHCDLKPQELIAEAR