EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06379 alignment
(2 sequences with 344 aa)


Q8D1F0_YERPE/19-362 MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWETMWSIGGLVSWLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIGIAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVALIGVAIVSYAGLLKERAMGIQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASALGINSLYVALPSYVIIMGGGAIINLSYCFIRLATLKNLSVKADFSVAKPLLITNILFSALAGLMWYLQFFFYAWGHAKIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKPVAVLCIGCLVIILAANIVGLGMAA
RHAT_SALTY/1-344 MSNAITMGIFWHLIGAASAACFYAPFKQVKQWSWETMWSVGGIVSWLILPWTISALLLPDFWAYYGQFNLSTLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIGIAIGITLIVGTLMTPIINGNFDVLIHTEGGRMTLLGVFVALIGVGIVTRAGQLKERKMGIKAEEFNLKKGLLLAVMCGIFSAGMSFAMNAAKPMHEAAAALGVDPLYVALPSYVVIMGGGALVNLGFCFIRLAKVQNLSIKADFSLARPLIISNILLSALGGLMWYLQFFFYAWGHARIPAQYDYMSWMLHMSFYVLCGGLVGLVLKEWKNAGRRPVAVLSLGCVVIIIAANIVGLGMAS