EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06365 alignment
(4 sequences with 396 aa)


Q9XS61_BOVIN/1-382 MLGRRGARAGRGMVRGWTALCLLSLLPSMEFTQTPMAATTATVSASPEISSPVPTTTFDWRSMNSSTFRSTSLYDVSQDSNGTTavTLVPASTDSFTSTSETLPASGAVNSSVQSQTSLATTVSSTLISFATSEATLQPSTFPGNISDSLYNSTS-PVTSSIITSP-SFSP......TQSILKSEIKCSRVKEVKLAHSICLKLNETSSCEEFKKNNEEKLTGFLCQKKQAE------VCSLLLAQSEVRPQCLLLVLTNRTESSSKIKLLEEHWSDLREMGIEDISEEAVSSHQSYSRKTLIALVTSGILLAILITTCYFLMNRRSWSPTGERLGEDPYYVENGGGQGYSSGPEASPEAQGKAIVNRGAQENGTGQATSRNGHSARQRVVADTEL
CD34_MOUSE/1-382 MQVHRDTRAGLLLPWRWVALCLMSLL------HLNNLTSATTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTT..PAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSS......APSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTLIALVTSGVLLAILGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGASPETQGKANVTRGAQENGTGQATSRNGHSARQHVVADTEL
CD34_CANFA/1-389 MLAGRGARAGGGLPRGWTALCLLSLL-PFGFTNTETVITPTTVPTSTEIMSAVSENTSKREAITLTPSGTTTLYSVSQDSSGTT..ATISETTVHVTSTSEITLTPGTMNSSVQSQTSLAITVSFTPTNFSTSSVTLEPSLLPGNGSDPPYNSTS-LVTSPTEYYT-SLSPtpsrndTPSTIKGEIKCSGVKEVKLNQGICLELNETSSCEDFKKDNEEKLTQVLCEKEPAEA--GAGVCSLLLAQSEVRPHCLLLVLANKTELFSKLQLLRKHQSDLKKLGIRDFTEQDVGSHQSYSRKTLIALVTSGILLAVLGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGVSPEAQGKASVNRGPQENGTGQATSRNGHSARQHMVADTEL
CD34_HUMAN/1-385 MLVRRGARAGPRMPRGWTALCLLSLL-PSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEAT..TNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTS-LATSPTKPYT-SSSP......ILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL