EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06304 alignment
(6 sequences with 105 aa)


Q9K5W1_BACHD/4-105 KKIIEGKREWRAHVSRVEKLPKDYQIVYKEIQKYLFKVGP-VELNEGIGLLSEILGFFEEGAAAGKGVLDVTGTDVAAFCDALIGD--SKTYADLYQESIQQHVD
Q9K5V7_BACHD/8-110 IGSLNDKREWKAMEARAKALPKEYHHAYKAIQKYMWTSGGPTDWQDTKRIFGGILDLFEEGAAEGKKVTDLTGEDVAAFCDELMKDT--KTWMDKYRTKLNDSIG
Q9CDZ2_LACLA/11-111 MIGLEEKREFHEFENRAQKLGENYYEDYKELKKYIWH-SGVTKWADFKFIFGQVLDLLEEAKIQDKELTDLIGPDVATFIDEMMDD---NSWGKKQKNKLNKELK
Q9CDZ3_LACLA/7-105 SDLLAEKKDWQEMQNRAKKLPKDFYQAYRSIQKYMFKMGA-TDW----HIFNDIIELFELAVVDGRSPAEVLGDDVATFADKLLSDN-KEDWRNKYRQALNDYFA
Q8Y922_LISMO/6-107 KKYREEKRDYKQYKKRIAALPEDYKTAMKAIETYLWNFAK---GAGMFEILKNVLEMFENAAADNLELKAVVGDDLAEFADNLLSEFPEETWMDKQRQKLRDSIK
Q9K5W0_BACHD/7-110 ITGSDMTKEMKGFETRAKVLPAEYRAAWEEITSNLWLHSDFT-GRNLMPILDSALELLEVASADGQSVEEVLGDDIEGFCAALVGDQGAKTFRDKWRDQLNKNVA