EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06299 alignment
(7 sequences with 232 aa)


Q98CW2_RHILO/1-232 MRYAIYFTPRQDEPLARIAANWLGRDPFGAATRPVEAVADLAAEEVAFHTASARRYGFHATLKAPFRLAASETEASLRAGLDHFAEATPVVTIPRLVVSQIDSFFALVPEGPLPPLNRFADEVVRDFDRFRAPLTEAEIERRSPDSLKPAEFRNLCQWGYPYVFETFRFHMTLSGRAGPQESPRLRAAINSLFADILRQPVLVDALTLFVEPEPGAPFMVLSQHALGRRPAR
Q8G162_BRUSU/1-232 MRYAIYFTPPSNDALLRVGANWLGRNAFSGEPVKMPALRSLETDEICRLTEKPRRYGFHATMKAPFRLAGEHSENDLLAALMHFASSAAPVVIPRLELQSISSFFALVPEEPVAELNQLANDVVVAFDRFRAPLSEAEIARRRPERLNERQRHNLVRWGYPYVFEEFRFHMTLTGPVEEKDRSRVERVLEEFFTPMLDDCVEVANLALFVEPEEGAPFEVHSLHPLSGGKAA
Q8UIX1_AGRT5/1-225 MRYAIYFSPAKDHPLTEAASRWLGRNAFSGT------LHD-DHDDYADLTEEPRRYGFHATLKAPFELAEKYSEAELLAAVEDFAANQSAFEIPRVVVGALGPFFALVPDRVYQPLQDFAAEVVDHFDRFRAPLSETDIARRRPQMLTESQRQNLSLWGYPHVMDDFRFHMTLTGRIDEEEQPAMQEILSTRFAEFVDQPLAISGLALFIEETRGAPFTVHRWHPLGQQPKK
Q92UG1_RHIME/1-232 MRYAICFTPPMGDPLSAAAASWLGRSVYSGEAVELPSIAGLAVSEMAFYTAVPRRFGFHAMIMAPFRLRPDMDEAQLLKAMMLFTSGETPFQIERLEVARLSQCWGLMPEVPSQSMHLLAARVLQALDRFRAPLSEDDIERADPDRLTAPQFTNLHRWGDPHVMDEYRFHMPLTGPLNVDVGRRVEAPLRGLFEPLLSEPLLIGSLALFIEHEPGAPMRVHSQHPLGKISAR
Q8UCZ9_AGRT5/1-232 MRYAIHFTPSPNDPLTQAAAAWLGRDVYSGHAVEPPGTIDLGMQEISYHTALPRRYGFHGTIKAPFRLAEGQSEAALLRDLMYFSGRQDPFTLPQLVVARQENVFSLVPERPCEVLHFFAARVVQEFDHYRAPLSEAEIERADPDRLSASQLTNLHRWGSPHVMDEFRFQMSLTGGVDPSSSQRIERAVRKVFEPLLTRTLQFSSLALFIEDEPGAPFRVHSLHPMGRVSAR
Q982C2_RHILO/9-236 RRYAIYYAPRPEHPLTAAAVHWLGRDAFGRVEVG----GDARPEGEVLLTSEPRRYGFHATLKAPFRLREGASAEDLEEALGGFAASRPACPIGPLKIDLIDGFFALVPVSPIPALRGFAAQIVEEFDCFRAPMDGDELERRMSRQFDEVEMTNLVTWGYPYVLGRFRFHLTLTDRVPENGRAATRARLEERFGPYLSEDYHIDTLSLFVQEHRGADFAVRSQFALKTGAAL
Q981P6_RHILO/7-233 PRYGIYYTPAREHPLTVAAISWLGRDAFQAD-----ATRDARPEAGGLITSEPRRYGFHATLKAPFRLREDTSVEELEQALGRFAASRPPCPIGPFKIDLFGDFFALVPASPIPTLRGFAAQTVEEFDRFRAPMDGDDLERRMSRQVDEVETTNLITWGYPYVLGLFRFHMTLTDRVPRDGREAMRARLEGRFEPYLSEDYHIDAMSLFVQEHRSADFVVRSQFALKTGAAL