EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06266 alignment
(5 sequences with 75 aa)


Q9FCZ3_ERWST/1-74 MSSLSSIQRRLDSQFERAKNQLDEATMNASEG-YSQADSFAFFEASMGLSSASWAATQELTVKHGLIKALINEIN
Q46623_ERWAM/1-74 MSSISALQRRLDSQFDKAQTQLDDATLDASEG-YSQEDSFAFFEASMGLSNASWAASQELTVKHGLAKAIINEIN
P94765_ERWCH/1-75 MSSSSPIQRRLDGAFVDAQSRLDEMAQSLSEGEVSMADSYAFYEASMDYSNANWAAGQMLSVKHGLAKAIINDFN
O87462_PSESG/1-74 MISFKSLQNNLDSTLNRALSDVDDVLEG-GNGHFTADDIDAFGEASQQAAVSSNIADQCQQAGYKMTKNVIDGFQ
O87439_PSESM/1-74 MISFNSLQRHLDNSVSRAHTNMDQAAMEASES-GTVEDLQAFTMSQQQVDVAGIAVNECLRAKHGINKAVIDGIQ